Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XVH4

Protein Details
Accession A0A0C2XVH4    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRLRRSRTHKAQRDVHRASRTRBasic
73-99AALRTHWRSKLHKRRCKKLKEPAYTIEHydrophilic
NLS Segment(s)
PositionSequence
6-26RSRTHKAQRDVHRASRTRARK
85-86KR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRLRRSRTHKAQRDVHRASRTRARKRDLDQIQLHDLIPGIRATLENQPLDVEKPGLAQHYCVECARYFEADAALRTHWRSKLHKRRCKKLKEPAYTIEEAEKAAGLGRETRTIPSSIAAAPPNPDTTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.83
4 0.82
5 0.76
6 0.72
7 0.73
8 0.73
9 0.73
10 0.74
11 0.71
12 0.7
13 0.71
14 0.75
15 0.71
16 0.7
17 0.65
18 0.6
19 0.58
20 0.5
21 0.45
22 0.35
23 0.29
24 0.19
25 0.15
26 0.11
27 0.07
28 0.06
29 0.06
30 0.08
31 0.13
32 0.17
33 0.16
34 0.16
35 0.16
36 0.17
37 0.17
38 0.16
39 0.11
40 0.07
41 0.08
42 0.09
43 0.1
44 0.1
45 0.09
46 0.11
47 0.12
48 0.13
49 0.12
50 0.13
51 0.11
52 0.14
53 0.14
54 0.12
55 0.11
56 0.1
57 0.12
58 0.11
59 0.11
60 0.1
61 0.1
62 0.11
63 0.12
64 0.15
65 0.17
66 0.21
67 0.29
68 0.39
69 0.5
70 0.6
71 0.68
72 0.74
73 0.82
74 0.86
75 0.89
76 0.88
77 0.87
78 0.87
79 0.86
80 0.83
81 0.78
82 0.74
83 0.65
84 0.56
85 0.47
86 0.37
87 0.28
88 0.22
89 0.16
90 0.09
91 0.1
92 0.1
93 0.08
94 0.12
95 0.13
96 0.17
97 0.18
98 0.2
99 0.21
100 0.21
101 0.21
102 0.18
103 0.19
104 0.17
105 0.2
106 0.19
107 0.18
108 0.2
109 0.21