Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BL11

Protein Details
Accession A0A0C3BL11    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRVLGHKRGKRNSRPNTSLIHydrophilic
NLS Segment(s)
PositionSequence
16-20KRGKR
Subcellular Location(s) nucl 14, mito_nucl 11.333, cyto_nucl 10.333, mito 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRGKRNSRPNTSLIQIEGVADKKEAQFYLGKRVAYVYRAKREIGGSKVRVIWGRVTRSHGNSGVVKSKFTSNLPPHAFGASVRIMLYPSNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.18
20 0.14
21 0.12
22 0.11
23 0.11
24 0.1
25 0.12
26 0.11
27 0.11
28 0.14
29 0.14
30 0.24
31 0.26
32 0.25
33 0.23
34 0.25
35 0.24
36 0.23
37 0.29
38 0.26
39 0.28
40 0.3
41 0.3
42 0.3
43 0.32
44 0.33
45 0.3
46 0.31
47 0.27
48 0.28
49 0.29
50 0.29
51 0.28
52 0.25
53 0.26
54 0.25
55 0.28
56 0.28
57 0.33
58 0.36
59 0.38
60 0.41
61 0.36
62 0.34
63 0.33
64 0.34
65 0.36
66 0.32
67 0.29
68 0.27
69 0.29
70 0.28
71 0.27
72 0.34
73 0.31
74 0.4
75 0.43
76 0.44
77 0.42
78 0.4
79 0.38
80 0.28
81 0.28
82 0.2
83 0.17
84 0.14
85 0.14
86 0.13