Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WPR4

Protein Details
Accession A0A0C2WPR4   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
69-97DFVCPTCRTRRARGSRKTSKKKGSAGGRGHydrophilic
NLS Segment(s)
PositionSequence
78-97RRARGSRKTSKKKGSAGGRG
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
PS50016  ZF_PHD_2  
Amino Acid Sequences GSFPSDTPFKFGEGSELAEGQTADEDSKPYCICGRPSFGQMIGCDDSECEFEWFHLQCLGITGTPPQGDFVCPTCRTRRARGSRKTSKKKGSAGGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.18
4 0.17
5 0.16
6 0.16
7 0.11
8 0.1
9 0.08
10 0.07
11 0.07
12 0.08
13 0.08
14 0.11
15 0.11
16 0.11
17 0.13
18 0.15
19 0.2
20 0.22
21 0.27
22 0.26
23 0.29
24 0.29
25 0.27
26 0.26
27 0.22
28 0.23
29 0.18
30 0.16
31 0.14
32 0.12
33 0.12
34 0.11
35 0.11
36 0.08
37 0.07
38 0.07
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.11
46 0.11
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.1
53 0.09
54 0.09
55 0.1
56 0.12
57 0.14
58 0.18
59 0.2
60 0.24
61 0.29
62 0.37
63 0.41
64 0.48
65 0.56
66 0.61
67 0.69
68 0.76
69 0.81
70 0.84
71 0.9
72 0.92
73 0.92
74 0.91
75 0.89
76 0.87
77 0.85