Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BLJ8

Protein Details
Accession A0A0C3BLJ8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
28-60VFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
Subcellular Location(s) mito 16, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEKCYFCSCNIYPGHGSAFVRNDSKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTIDSTIEFEKRRNVPVRYDRELIQTTIKAMKRVAEIKQKRERAFWKHRMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.33
4 0.29
5 0.29
6 0.25
7 0.27
8 0.25
9 0.26
10 0.24
11 0.24
12 0.23
13 0.26
14 0.26
15 0.26
16 0.27
17 0.3
18 0.3
19 0.39
20 0.44
21 0.5
22 0.53
23 0.59
24 0.63
25 0.69
26 0.78
27 0.78
28 0.81
29 0.83
30 0.86
31 0.88
32 0.9
33 0.88
34 0.9
35 0.88
36 0.87
37 0.86
38 0.85
39 0.83
40 0.84
41 0.82
42 0.73
43 0.73
44 0.64
45 0.62
46 0.55
47 0.46
48 0.37
49 0.32
50 0.3
51 0.22
52 0.2
53 0.12
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.17
60 0.19
61 0.25
62 0.31
63 0.33
64 0.4
65 0.49
66 0.56
67 0.55
68 0.55
69 0.5
70 0.49
71 0.49
72 0.41
73 0.35
74 0.28
75 0.25
76 0.3
77 0.3
78 0.26
79 0.24
80 0.26
81 0.29
82 0.33
83 0.38
84 0.42
85 0.48
86 0.56
87 0.65
88 0.7
89 0.67
90 0.71
91 0.73
92 0.72
93 0.76