Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9CXS8

Protein Details
Accession E9CXS8    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
69-92CKGDVKRTMERRRRHKECKPGDGGBasic
NLS Segment(s)
Subcellular Location(s) plas 12, cyto 5, mito 3, cyto_pero 3, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MDLPPEMHLHIISHLSYPDALALKHTNSYFYSLVTTNVQFRVNWIIERVSSGLPILWRKCELRTDESFCKGDVKRTMERRRRHKECKPGDGGCAVVAGSNCGGASSELYWQFRRCKVLMRRATKIALEHQMLAIGLLLCIIAVLSQILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.13
6 0.12
7 0.11
8 0.14
9 0.16
10 0.16
11 0.21
12 0.21
13 0.2
14 0.2
15 0.25
16 0.21
17 0.19
18 0.21
19 0.17
20 0.19
21 0.19
22 0.2
23 0.17
24 0.19
25 0.2
26 0.17
27 0.18
28 0.23
29 0.21
30 0.2
31 0.19
32 0.18
33 0.17
34 0.18
35 0.18
36 0.12
37 0.11
38 0.1
39 0.1
40 0.11
41 0.15
42 0.15
43 0.15
44 0.17
45 0.18
46 0.2
47 0.24
48 0.26
49 0.28
50 0.32
51 0.37
52 0.38
53 0.4
54 0.39
55 0.34
56 0.35
57 0.29
58 0.3
59 0.28
60 0.3
61 0.33
62 0.42
63 0.52
64 0.55
65 0.63
66 0.69
67 0.74
68 0.78
69 0.81
70 0.8
71 0.81
72 0.8
73 0.81
74 0.77
75 0.67
76 0.6
77 0.51
78 0.43
79 0.32
80 0.24
81 0.15
82 0.09
83 0.08
84 0.07
85 0.06
86 0.06
87 0.05
88 0.05
89 0.06
90 0.05
91 0.06
92 0.06
93 0.1
94 0.13
95 0.15
96 0.18
97 0.21
98 0.26
99 0.29
100 0.33
101 0.3
102 0.37
103 0.44
104 0.53
105 0.59
106 0.61
107 0.63
108 0.62
109 0.64
110 0.57
111 0.51
112 0.46
113 0.43
114 0.38
115 0.33
116 0.29
117 0.27
118 0.24
119 0.21
120 0.16
121 0.09
122 0.07
123 0.06
124 0.06
125 0.04
126 0.04
127 0.04
128 0.03
129 0.03