Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XQQ2

Protein Details
Accession A0A0C2XQQ2   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-77CTGLTSPSMHRKKRRPLSRRSIQYIEHydrophilic
NLS Segment(s)
PositionSequence
62-70RKKRRPLSR
Subcellular Location(s) nucl 18, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MECFHVCLGWWVLSAHWIDALLLACRNHAQIQVSRETAKRRSSGQETALYACTGLTSPSMHRKKRRPLSRRSIQYIESRKAFSVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.1
4 0.1
5 0.08
6 0.1
7 0.11
8 0.09
9 0.11
10 0.1
11 0.11
12 0.11
13 0.13
14 0.12
15 0.13
16 0.15
17 0.16
18 0.2
19 0.22
20 0.23
21 0.24
22 0.26
23 0.28
24 0.31
25 0.3
26 0.29
27 0.28
28 0.32
29 0.35
30 0.36
31 0.35
32 0.34
33 0.31
34 0.31
35 0.29
36 0.24
37 0.19
38 0.15
39 0.11
40 0.07
41 0.06
42 0.06
43 0.06
44 0.09
45 0.2
46 0.28
47 0.36
48 0.45
49 0.54
50 0.64
51 0.74
52 0.82
53 0.8
54 0.83
55 0.86
56 0.88
57 0.88
58 0.85
59 0.79
60 0.73
61 0.74
62 0.71
63 0.68
64 0.61
65 0.54