Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AI54

Protein Details
Accession A0A0C3AI54   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-171LLTFLIAERKKRKRRETRTQQAEAIAHydrophilic
NLS Segment(s)
PositionSequence
154-160RKKRKRR
Subcellular Location(s) mito 15, mito_nucl 11.833, cyto_mito 9.833, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MSVNLHFANGSIRNTTISCDSLGIHYTVSKNRKVISLSRWDGRTNSNVVVGEFKLPFFRKDRIRVGPNGKWQPMRDYFDKPGMFSTSMTFRSNNGVKYTWKEHHGHLIMTRSGKKGALIKYHRNRWKSSYLEVLDSSTINGLDTILLTFLIAERKKRKRRETRTQQAEAIASGVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.21
4 0.18
5 0.17
6 0.16
7 0.16
8 0.16
9 0.17
10 0.15
11 0.12
12 0.14
13 0.16
14 0.23
15 0.27
16 0.29
17 0.3
18 0.31
19 0.35
20 0.36
21 0.39
22 0.38
23 0.44
24 0.44
25 0.47
26 0.47
27 0.45
28 0.43
29 0.41
30 0.38
31 0.31
32 0.27
33 0.25
34 0.23
35 0.22
36 0.22
37 0.19
38 0.18
39 0.15
40 0.14
41 0.17
42 0.17
43 0.2
44 0.21
45 0.27
46 0.31
47 0.37
48 0.45
49 0.47
50 0.51
51 0.55
52 0.59
53 0.59
54 0.61
55 0.6
56 0.56
57 0.51
58 0.48
59 0.47
60 0.45
61 0.44
62 0.38
63 0.37
64 0.36
65 0.4
66 0.39
67 0.33
68 0.29
69 0.26
70 0.23
71 0.19
72 0.18
73 0.14
74 0.16
75 0.17
76 0.16
77 0.14
78 0.19
79 0.21
80 0.21
81 0.2
82 0.2
83 0.2
84 0.24
85 0.29
86 0.26
87 0.28
88 0.29
89 0.27
90 0.34
91 0.34
92 0.31
93 0.28
94 0.29
95 0.26
96 0.28
97 0.29
98 0.22
99 0.22
100 0.21
101 0.21
102 0.23
103 0.25
104 0.32
105 0.36
106 0.45
107 0.53
108 0.63
109 0.68
110 0.66
111 0.65
112 0.61
113 0.63
114 0.56
115 0.51
116 0.5
117 0.45
118 0.43
119 0.4
120 0.36
121 0.28
122 0.24
123 0.21
124 0.12
125 0.11
126 0.08
127 0.07
128 0.06
129 0.05
130 0.06
131 0.05
132 0.05
133 0.05
134 0.04
135 0.04
136 0.06
137 0.13
138 0.15
139 0.23
140 0.32
141 0.43
142 0.53
143 0.64
144 0.74
145 0.78
146 0.87
147 0.9
148 0.92
149 0.93
150 0.93
151 0.89
152 0.81
153 0.73
154 0.64
155 0.52
156 0.42