Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XAU5

Protein Details
Accession A0A0C2XAU5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26SSGQGKAAKKKKWSKGKVKDKAAHAVHydrophilic
NLS Segment(s)
PositionSequence
6-21KAAKKKKWSKGKVKDK
Subcellular Location(s) mito 10, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences SSGQGKAAKKKKWSKGKVKDKAAHAVVLDKATYDRIIKDVPTFRFISPAILIERLKINGSLARIAIRHLEKEGTIKRIVHHNGQLIYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.91
4 0.91
5 0.91
6 0.88
7 0.81
8 0.79
9 0.7
10 0.6
11 0.49
12 0.42
13 0.33
14 0.27
15 0.22
16 0.13
17 0.12
18 0.11
19 0.12
20 0.09
21 0.09
22 0.1
23 0.11
24 0.11
25 0.15
26 0.2
27 0.2
28 0.23
29 0.24
30 0.22
31 0.24
32 0.24
33 0.21
34 0.16
35 0.16
36 0.14
37 0.14
38 0.14
39 0.13
40 0.14
41 0.13
42 0.13
43 0.12
44 0.12
45 0.11
46 0.13
47 0.13
48 0.12
49 0.13
50 0.12
51 0.13
52 0.18
53 0.18
54 0.18
55 0.18
56 0.19
57 0.18
58 0.26
59 0.3
60 0.28
61 0.3
62 0.3
63 0.31
64 0.39
65 0.43
66 0.42
67 0.43
68 0.45