Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AVT3

Protein Details
Accession A0A0C3AVT3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-108AEENPKRGQRPEKKPKKAKATDGSEKENKTKGKGKKAKRETEASSBasic
NLS Segment(s)
PositionSequence
68-102PKRGQRPEKKPKKAKATDGSEKENKTKGKGKKAKR
Subcellular Location(s) nucl 13.5, mito 10.5, cyto_nucl 8.333, cyto_mito 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKSSTKSASAASSSSPAADTKGKREKSAYQIWCSENRERVKAEFPDLKGKDILVKLNDQWWDAEENPKRGQRPEKKPKKAKATDGSEKENKTKGKGKKAKRETEASSEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.16
4 0.13
5 0.14
6 0.2
7 0.21
8 0.27
9 0.37
10 0.38
11 0.39
12 0.44
13 0.47
14 0.48
15 0.56
16 0.52
17 0.47
18 0.5
19 0.51
20 0.52
21 0.5
22 0.47
23 0.45
24 0.43
25 0.41
26 0.38
27 0.38
28 0.38
29 0.34
30 0.35
31 0.33
32 0.31
33 0.38
34 0.37
35 0.36
36 0.3
37 0.29
38 0.27
39 0.23
40 0.24
41 0.15
42 0.16
43 0.14
44 0.18
45 0.18
46 0.15
47 0.14
48 0.12
49 0.14
50 0.13
51 0.21
52 0.22
53 0.25
54 0.29
55 0.32
56 0.33
57 0.35
58 0.45
59 0.47
60 0.55
61 0.62
62 0.69
63 0.77
64 0.85
65 0.89
66 0.9
67 0.87
68 0.86
69 0.84
70 0.82
71 0.82
72 0.77
73 0.76
74 0.71
75 0.67
76 0.61
77 0.58
78 0.51
79 0.47
80 0.51
81 0.52
82 0.57
83 0.63
84 0.69
85 0.74
86 0.82
87 0.86
88 0.84
89 0.84
90 0.78