Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3B6P3

Protein Details
Accession A0A0C3B6P3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-67QCTPKFSRRAFRRFRSHRTCLRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, cyto 4, mito 3, plas 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MFPSQTKTHARIPALSPLILVSSPLRCLEWPPIKSPLVYVVCHACQCTPKFSRRAFRRFRSHRTCLRPLTATAAIPDYSEWVPECF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.32
4 0.26
5 0.25
6 0.2
7 0.18
8 0.11
9 0.1
10 0.11
11 0.12
12 0.12
13 0.11
14 0.14
15 0.22
16 0.28
17 0.29
18 0.31
19 0.35
20 0.34
21 0.34
22 0.32
23 0.31
24 0.25
25 0.24
26 0.21
27 0.19
28 0.2
29 0.2
30 0.2
31 0.13
32 0.15
33 0.16
34 0.21
35 0.22
36 0.27
37 0.34
38 0.39
39 0.49
40 0.53
41 0.62
42 0.65
43 0.7
44 0.76
45 0.77
46 0.82
47 0.81
48 0.81
49 0.8
50 0.79
51 0.79
52 0.72
53 0.69
54 0.61
55 0.53
56 0.52
57 0.45
58 0.37
59 0.3
60 0.27
61 0.22
62 0.2
63 0.19
64 0.16
65 0.13
66 0.14