Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D027

Protein Details
Accession E9D027   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-56VLRLRGGAKKRKKKVYTTPKKIKHKRKKTKLSVLKYYKVBasic
NLS Segment(s)
PositionSequence
21-47LRGGAKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences GRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKRKKTKLSVLKYYKVDADGKIERLRRECPSAECGAGVFMAAMHNRQYCGKCHLTYVFDESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.22
4 0.26
5 0.26
6 0.27
7 0.25
8 0.22
9 0.24
10 0.32
11 0.37
12 0.44
13 0.53
14 0.61
15 0.7
16 0.74
17 0.79
18 0.82
19 0.84
20 0.85
21 0.85
22 0.87
23 0.86
24 0.91
25 0.92
26 0.92
27 0.92
28 0.92
29 0.92
30 0.93
31 0.94
32 0.93
33 0.94
34 0.92
35 0.88
36 0.87
37 0.82
38 0.77
39 0.67
40 0.57
41 0.47
42 0.4
43 0.34
44 0.24
45 0.23
46 0.2
47 0.22
48 0.25
49 0.28
50 0.28
51 0.29
52 0.32
53 0.3
54 0.33
55 0.32
56 0.31
57 0.33
58 0.33
59 0.3
60 0.26
61 0.22
62 0.18
63 0.15
64 0.12
65 0.06
66 0.04
67 0.06
68 0.06
69 0.08
70 0.1
71 0.12
72 0.13
73 0.19
74 0.21
75 0.22
76 0.29
77 0.34
78 0.32
79 0.36
80 0.39
81 0.37
82 0.38