Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WA73

Protein Details
Accession A0A0C2WA73    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-46VISQMRKVRGKREKEKKKKRKQTVRQEREGRKGBasic
NLS Segment(s)
PositionSequence
19-51RKVRGKREKEKKKKRKQTVRQEREGRKGGPKGN
Subcellular Location(s) nucl 11, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MRWLAAAEREERVVISQMRKVRGKREKEKKKKRKQTVRQEREGRKGGPKGNAPLAVRSRLIYLTGLSPSTKEVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.25
4 0.28
5 0.34
6 0.4
7 0.41
8 0.47
9 0.52
10 0.59
11 0.65
12 0.72
13 0.77
14 0.82
15 0.91
16 0.92
17 0.94
18 0.95
19 0.95
20 0.95
21 0.94
22 0.95
23 0.95
24 0.92
25 0.9
26 0.89
27 0.84
28 0.8
29 0.74
30 0.65
31 0.6
32 0.57
33 0.52
34 0.48
35 0.46
36 0.42
37 0.42
38 0.44
39 0.39
40 0.4
41 0.39
42 0.36
43 0.32
44 0.29
45 0.26
46 0.22
47 0.22
48 0.16
49 0.14
50 0.14
51 0.15
52 0.16
53 0.14
54 0.14