Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WBC9

Protein Details
Accession A0A0C2WBC9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
175-195LTTKKFPQKKQPKEGLARKAAHydrophilic
224-244TETNKIWRKPKNNPEVPRTPHHydrophilic
NLS Segment(s)
PositionSequence
159-221RCPKMAGKRRPEQKGPLTTKKFPQKKQPKEGLARKAAGKRTPNKARQPPPEPTPKLMPPKPPM
Subcellular Location(s) mito 10, cyto 7.5, cyto_nucl 6, nucl 3.5, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR045002  Ech1-like  
IPR001753  Enoyl-CoA_hydra/iso  
IPR014748  Enoyl-CoA_hydra_C  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006635  P:fatty acid beta-oxidation  
Pfam View protein in Pfam  
PF00378  ECH_1  
CDD cd06558  crotonase-like  
Amino Acid Sequences MSSPSFFKISSPHDGVLLVEMNRPPVNAFNETFWKQLQAVFNQASKDPAVRAVVLASALPKLFTAGLDLKETDILKDAGDMDPARRALLLREHILEFQAAISSIEKCIKPVIAAAHGLCLGLAIDILCAADVRYAAASARFSIKKVNEGRPPKMETLPRCPKMAGKRRPEQKGPLTTKKFPQKKQPKEGLARKAAGKRTPNKARQPPPEPTPKLMPPKPPMPATETNKIWRKPKNNPEVPRTPHVLTLMAPGSIDESLSYTATWNQGMLQSLDTPLAIQSAVSRKPVSFKPLPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.28
4 0.25
5 0.18
6 0.18
7 0.18
8 0.21
9 0.21
10 0.21
11 0.19
12 0.21
13 0.25
14 0.26
15 0.27
16 0.27
17 0.35
18 0.36
19 0.37
20 0.32
21 0.3
22 0.26
23 0.29
24 0.3
25 0.25
26 0.29
27 0.31
28 0.33
29 0.31
30 0.31
31 0.29
32 0.25
33 0.24
34 0.18
35 0.18
36 0.17
37 0.16
38 0.16
39 0.14
40 0.13
41 0.12
42 0.11
43 0.09
44 0.08
45 0.08
46 0.08
47 0.07
48 0.08
49 0.08
50 0.07
51 0.11
52 0.13
53 0.15
54 0.16
55 0.17
56 0.16
57 0.19
58 0.19
59 0.15
60 0.14
61 0.13
62 0.11
63 0.11
64 0.12
65 0.1
66 0.12
67 0.12
68 0.11
69 0.14
70 0.15
71 0.14
72 0.13
73 0.13
74 0.13
75 0.19
76 0.22
77 0.2
78 0.22
79 0.23
80 0.23
81 0.23
82 0.2
83 0.13
84 0.1
85 0.08
86 0.06
87 0.06
88 0.06
89 0.06
90 0.08
91 0.11
92 0.11
93 0.11
94 0.12
95 0.12
96 0.11
97 0.13
98 0.14
99 0.12
100 0.14
101 0.13
102 0.13
103 0.12
104 0.12
105 0.09
106 0.07
107 0.05
108 0.04
109 0.04
110 0.03
111 0.02
112 0.02
113 0.03
114 0.02
115 0.02
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.1
127 0.11
128 0.11
129 0.16
130 0.16
131 0.23
132 0.28
133 0.34
134 0.38
135 0.43
136 0.47
137 0.46
138 0.49
139 0.43
140 0.43
141 0.41
142 0.37
143 0.42
144 0.48
145 0.45
146 0.43
147 0.41
148 0.42
149 0.47
150 0.54
151 0.52
152 0.51
153 0.57
154 0.65
155 0.71
156 0.7
157 0.68
158 0.65
159 0.66
160 0.66
161 0.68
162 0.65
163 0.62
164 0.66
165 0.68
166 0.68
167 0.63
168 0.66
169 0.67
170 0.71
171 0.78
172 0.79
173 0.77
174 0.79
175 0.83
176 0.81
177 0.75
178 0.68
179 0.63
180 0.59
181 0.56
182 0.52
183 0.52
184 0.5
185 0.55
186 0.62
187 0.66
188 0.7
189 0.75
190 0.78
191 0.8
192 0.79
193 0.75
194 0.72
195 0.74
196 0.67
197 0.61
198 0.58
199 0.56
200 0.59
201 0.57
202 0.59
203 0.54
204 0.56
205 0.57
206 0.53
207 0.48
208 0.46
209 0.51
210 0.49
211 0.51
212 0.49
213 0.52
214 0.58
215 0.6
216 0.6
217 0.59
218 0.62
219 0.64
220 0.71
221 0.74
222 0.76
223 0.79
224 0.81
225 0.82
226 0.79
227 0.74
228 0.69
229 0.59
230 0.52
231 0.46
232 0.39
233 0.29
234 0.28
235 0.24
236 0.18
237 0.17
238 0.14
239 0.14
240 0.12
241 0.12
242 0.07
243 0.07
244 0.09
245 0.09
246 0.1
247 0.09
248 0.12
249 0.14
250 0.14
251 0.12
252 0.12
253 0.14
254 0.16
255 0.16
256 0.15
257 0.14
258 0.15
259 0.15
260 0.14
261 0.12
262 0.1
263 0.1
264 0.08
265 0.07
266 0.11
267 0.18
268 0.2
269 0.24
270 0.25
271 0.26
272 0.32
273 0.37
274 0.41
275 0.43