Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2X6A4

Protein Details
Accession A0A0C2X6A4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
192-220TDALAKIKLKKRKNRKRRRALNARHANLIHydrophilic
NLS Segment(s)
PositionSequence
196-212AKIKLKKRKNRKRRRAL
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006565  BTP  
IPR009072  Histone-fold  
IPR037818  TAF8  
IPR019473  TFIID_su8_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF07524  Bromo_TP  
PF10406  TAF8_C  
Amino Acid Sequences MSYPPTPGGMMPYPHGYYPQYQGYPTPQTPTGMQTPYGYHGYMGGHPPFPHGLPSSQGVPGYYAEDGGAENDEDEDEDEGAMDEEDEDVDMEMPLDQESAEKAMKHMIYTQLFTEGFDGGQASAVDLLLKEVVGYMQQLYLATQEYGHQAGRAVPSAHDFVAACDEMGITPKMLKPNLQFERAAPLRKAASTDALAKIKLKKRKNRKRRRALNARHANLIPRDLSSPEPELLPSEEYPHIPATLRSLQPPHHLNPYHAHQSTSTSASSTFPPAYPPKHTYIRSPPSPPQRSSLTASLDKRMQNTAKVRAALKNMMDAADIPKEIDTTEGVDGKPLASRYHLTNSSLVNWQETFTTTRRRWKVAKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.27
4 0.26
5 0.3
6 0.35
7 0.31
8 0.31
9 0.34
10 0.37
11 0.43
12 0.41
13 0.4
14 0.34
15 0.35
16 0.35
17 0.37
18 0.37
19 0.31
20 0.31
21 0.28
22 0.28
23 0.3
24 0.3
25 0.25
26 0.19
27 0.19
28 0.2
29 0.21
30 0.24
31 0.23
32 0.24
33 0.24
34 0.26
35 0.27
36 0.25
37 0.25
38 0.22
39 0.21
40 0.2
41 0.23
42 0.23
43 0.22
44 0.22
45 0.19
46 0.18
47 0.17
48 0.17
49 0.14
50 0.11
51 0.1
52 0.1
53 0.09
54 0.08
55 0.08
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.08
87 0.09
88 0.09
89 0.09
90 0.14
91 0.15
92 0.15
93 0.17
94 0.21
95 0.22
96 0.23
97 0.23
98 0.22
99 0.21
100 0.21
101 0.19
102 0.13
103 0.11
104 0.1
105 0.1
106 0.06
107 0.07
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.03
118 0.03
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.06
128 0.07
129 0.06
130 0.06
131 0.07
132 0.08
133 0.09
134 0.09
135 0.09
136 0.08
137 0.1
138 0.11
139 0.12
140 0.11
141 0.1
142 0.12
143 0.13
144 0.13
145 0.12
146 0.11
147 0.09
148 0.11
149 0.11
150 0.08
151 0.07
152 0.07
153 0.06
154 0.08
155 0.08
156 0.05
157 0.06
158 0.08
159 0.11
160 0.12
161 0.15
162 0.16
163 0.25
164 0.29
165 0.3
166 0.29
167 0.26
168 0.34
169 0.33
170 0.33
171 0.23
172 0.22
173 0.2
174 0.2
175 0.22
176 0.14
177 0.14
178 0.13
179 0.16
180 0.17
181 0.17
182 0.17
183 0.18
184 0.25
185 0.29
186 0.36
187 0.41
188 0.48
189 0.58
190 0.69
191 0.79
192 0.83
193 0.88
194 0.91
195 0.93
196 0.95
197 0.94
198 0.93
199 0.93
200 0.92
201 0.82
202 0.75
203 0.65
204 0.57
205 0.47
206 0.39
207 0.28
208 0.19
209 0.18
210 0.16
211 0.17
212 0.16
213 0.17
214 0.15
215 0.15
216 0.14
217 0.14
218 0.14
219 0.15
220 0.12
221 0.14
222 0.14
223 0.14
224 0.16
225 0.15
226 0.15
227 0.13
228 0.13
229 0.15
230 0.2
231 0.21
232 0.22
233 0.24
234 0.26
235 0.31
236 0.36
237 0.32
238 0.35
239 0.35
240 0.35
241 0.38
242 0.41
243 0.44
244 0.4
245 0.38
246 0.3
247 0.33
248 0.34
249 0.31
250 0.25
251 0.17
252 0.17
253 0.17
254 0.18
255 0.17
256 0.16
257 0.13
258 0.18
259 0.23
260 0.26
261 0.31
262 0.34
263 0.37
264 0.43
265 0.45
266 0.47
267 0.53
268 0.58
269 0.57
270 0.59
271 0.61
272 0.65
273 0.7
274 0.64
275 0.58
276 0.55
277 0.53
278 0.52
279 0.49
280 0.45
281 0.45
282 0.45
283 0.45
284 0.45
285 0.43
286 0.4
287 0.42
288 0.38
289 0.39
290 0.43
291 0.47
292 0.47
293 0.48
294 0.49
295 0.47
296 0.5
297 0.47
298 0.41
299 0.37
300 0.32
301 0.29
302 0.27
303 0.23
304 0.21
305 0.18
306 0.17
307 0.14
308 0.13
309 0.13
310 0.13
311 0.13
312 0.1
313 0.1
314 0.13
315 0.15
316 0.15
317 0.16
318 0.17
319 0.16
320 0.19
321 0.17
322 0.16
323 0.17
324 0.2
325 0.23
326 0.31
327 0.34
328 0.33
329 0.36
330 0.37
331 0.36
332 0.4
333 0.36
334 0.31
335 0.28
336 0.26
337 0.23
338 0.23
339 0.24
340 0.23
341 0.32
342 0.35
343 0.45
344 0.5
345 0.57