Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3AM37

Protein Details
Accession A0A0C3AM37    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-25FSVVARPFKRRKIRHGEGGPNAHydrophilic
NLS Segment(s)
PositionSequence
12-15KRRK
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MPDFSVVARPFKRRKIRHGEGGPNASGQATPVPEVADIPSSDEPPPDAPTELLDIESSISKATDLRDPLKATTEALKKVRETGKVSVYVTTADAVWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.75
3 0.79
4 0.81
5 0.82
6 0.82
7 0.78
8 0.75
9 0.65
10 0.55
11 0.46
12 0.36
13 0.26
14 0.18
15 0.12
16 0.08
17 0.09
18 0.09
19 0.09
20 0.09
21 0.09
22 0.09
23 0.09
24 0.08
25 0.11
26 0.11
27 0.12
28 0.12
29 0.12
30 0.12
31 0.12
32 0.14
33 0.11
34 0.11
35 0.09
36 0.1
37 0.11
38 0.11
39 0.09
40 0.08
41 0.07
42 0.07
43 0.07
44 0.06
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.11
51 0.14
52 0.17
53 0.21
54 0.23
55 0.23
56 0.26
57 0.25
58 0.22
59 0.27
60 0.29
61 0.31
62 0.33
63 0.36
64 0.32
65 0.4
66 0.43
67 0.42
68 0.42
69 0.42
70 0.44
71 0.45
72 0.45
73 0.39
74 0.35
75 0.3
76 0.26
77 0.21