Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BRJ1

Protein Details
Accession A0A0C3BRJ1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAPTIVKKRVKPFKRHQSDRYHTVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-50KKRVKPFKRHQSDRYHTVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 12.5, mito_nucl 11, mito 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPTIVKKRVKPFKRHQSDRYHTVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLMPNGLKKFLVNNEKELELLLMHNKSYAAEIAHGVSSKNRIGLLARAKALGIKVTNPAARVRTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.88
4 0.88
5 0.87
6 0.85
7 0.82
8 0.75
9 0.65
10 0.62
11 0.61
12 0.6
13 0.61
14 0.61
15 0.6
16 0.58
17 0.59
18 0.61
19 0.64
20 0.64
21 0.64
22 0.66
23 0.71
24 0.79
25 0.83
26 0.76
27 0.74
28 0.71
29 0.68
30 0.68
31 0.64
32 0.64
33 0.64
34 0.66
35 0.59
36 0.52
37 0.46
38 0.38
39 0.38
40 0.33
41 0.35
42 0.4
43 0.42
44 0.42
45 0.46
46 0.47
47 0.47
48 0.46
49 0.47
50 0.45
51 0.54
52 0.54
53 0.52
54 0.48
55 0.4
56 0.38
57 0.35
58 0.35
59 0.26
60 0.27
61 0.27
62 0.27
63 0.27
64 0.25
65 0.18
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.1
76 0.07
77 0.08
78 0.09
79 0.09
80 0.1
81 0.1
82 0.1
83 0.1
84 0.13
85 0.13
86 0.14
87 0.13
88 0.13
89 0.14
90 0.21
91 0.27
92 0.28
93 0.28
94 0.27
95 0.27
96 0.28
97 0.27
98 0.25
99 0.19
100 0.16
101 0.19
102 0.25
103 0.26
104 0.26
105 0.3
106 0.28