Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3ATS8

Protein Details
Accession A0A0C3ATS8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-124LEARSGKKHRHGKHGKHGKHKKHGKHGKHKKHHKKHRKGGKARKAQMQAQBasic
NLS Segment(s)
PositionSequence
78-119RSGKKHRHGKHGKHGKHKKHGKHGKHKKHHKKHRKGGKARKA
Subcellular Location(s) extr 18, mito 6, plas 2
Family & Domain DBs
Amino Acid Sequences MRFATALIVISAAVCVLAAPIHHVTSHPDSDMALQAAHVHNSVSALHEHNHSLQVSHGEAGDALQPRSLEHMNELEARSGKKHRHGKHGKHGKHKKHGKHGKHKKHHKKHRKGGKARKAQMQAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.07
7 0.09
8 0.1
9 0.1
10 0.11
11 0.16
12 0.21
13 0.22
14 0.19
15 0.18
16 0.18
17 0.19
18 0.2
19 0.15
20 0.1
21 0.09
22 0.11
23 0.11
24 0.11
25 0.1
26 0.08
27 0.08
28 0.08
29 0.09
30 0.07
31 0.08
32 0.09
33 0.1
34 0.11
35 0.12
36 0.12
37 0.15
38 0.13
39 0.12
40 0.11
41 0.12
42 0.11
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.12
55 0.12
56 0.09
57 0.1
58 0.11
59 0.12
60 0.14
61 0.15
62 0.13
63 0.14
64 0.15
65 0.16
66 0.21
67 0.23
68 0.3
69 0.39
70 0.43
71 0.53
72 0.63
73 0.69
74 0.75
75 0.82
76 0.8
77 0.82
78 0.87
79 0.86
80 0.86
81 0.87
82 0.85
83 0.85
84 0.88
85 0.87
86 0.89
87 0.9
88 0.91
89 0.92
90 0.95
91 0.95
92 0.96
93 0.96
94 0.96
95 0.96
96 0.96
97 0.96
98 0.96
99 0.95
100 0.95
101 0.95
102 0.94
103 0.91
104 0.89