Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BRC6

Protein Details
Accession Q6BRC6    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPRQSKTAKRSKVQNKTRTVESHydrophilic
171-191LARANRRKSAKSQKNEESKAAHydrophilic
NLS Segment(s)
PositionSequence
91-101VKAKKGKKGKK
143-197KKQELERKEEQKENKLEGKKNEVKSKASLARANRRKSAKSQKNEESKAASNKGKK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG dha:DEHA2D17402g  -  
Amino Acid Sequences MAPRQSKTAKRSKVQNKTRTVESEVGSDSAARNLLMSQPKLTPKSIVKAPSKAAVKKQQAKIRLYGARSGKEYREDQLDIPALNKAITPGVKAKKGKKGKKFVEDNDALTLNRLVKSINDKYDQANESKLEKSRRLDEIRELKKQELERKEEQKENKLEGKKNEVKSKASLARANRRKSAKSQKNEESKAASNKGKKSVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.84
4 0.8
5 0.79
6 0.73
7 0.68
8 0.62
9 0.53
10 0.47
11 0.38
12 0.34
13 0.28
14 0.23
15 0.18
16 0.14
17 0.13
18 0.1
19 0.09
20 0.08
21 0.14
22 0.19
23 0.2
24 0.21
25 0.25
26 0.31
27 0.34
28 0.34
29 0.34
30 0.32
31 0.37
32 0.4
33 0.43
34 0.42
35 0.44
36 0.45
37 0.46
38 0.49
39 0.47
40 0.5
41 0.51
42 0.56
43 0.61
44 0.66
45 0.65
46 0.66
47 0.65
48 0.61
49 0.59
50 0.54
51 0.47
52 0.46
53 0.44
54 0.39
55 0.4
56 0.38
57 0.33
58 0.33
59 0.32
60 0.27
61 0.28
62 0.26
63 0.23
64 0.24
65 0.24
66 0.19
67 0.18
68 0.16
69 0.12
70 0.11
71 0.1
72 0.07
73 0.08
74 0.08
75 0.09
76 0.15
77 0.18
78 0.24
79 0.29
80 0.34
81 0.41
82 0.51
83 0.58
84 0.61
85 0.68
86 0.69
87 0.74
88 0.75
89 0.69
90 0.67
91 0.6
92 0.52
93 0.44
94 0.38
95 0.28
96 0.22
97 0.2
98 0.13
99 0.11
100 0.1
101 0.08
102 0.09
103 0.16
104 0.2
105 0.23
106 0.24
107 0.24
108 0.26
109 0.32
110 0.32
111 0.26
112 0.24
113 0.22
114 0.22
115 0.24
116 0.27
117 0.26
118 0.3
119 0.32
120 0.35
121 0.41
122 0.43
123 0.42
124 0.46
125 0.52
126 0.53
127 0.57
128 0.54
129 0.48
130 0.49
131 0.52
132 0.52
133 0.49
134 0.5
135 0.52
136 0.58
137 0.62
138 0.64
139 0.64
140 0.64
141 0.61
142 0.6
143 0.6
144 0.59
145 0.59
146 0.57
147 0.62
148 0.61
149 0.63
150 0.66
151 0.62
152 0.59
153 0.56
154 0.6
155 0.56
156 0.54
157 0.52
158 0.52
159 0.59
160 0.65
161 0.67
162 0.66
163 0.66
164 0.65
165 0.7
166 0.73
167 0.72
168 0.73
169 0.76
170 0.78
171 0.82
172 0.82
173 0.76
174 0.71
175 0.68
176 0.66
177 0.64
178 0.62
179 0.59
180 0.61
181 0.65
182 0.64