Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3AWC4

Protein Details
Accession A0A0C3AWC4    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
351-385RDTSRDKRSGRDRSRSRDRRDRDRDRDRDRDYDRRBasic
NLS Segment(s)
PositionSequence
332-412KQKGGPKPSKKYIPVIAKGRDTSRDKRSGRDRSRSRDRRDRDRDRDRDRDYDRRDGRSGSHRRDDGRESERRSESGRDRAR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MSTNFTVRRPTPVSNDGSDVDSTPNFKVPALPQHLRNNHKASASSPLNPNGKRALTFGDSDDEDDGATDELVVSFDAMGAQRCVDVAHIYKISSSYHSPKLLDAFHSAAGAPVKNAPLVIPAIPNKDWRAAARQRKGFRPDESKTKIGVDGSQGGLGTRDTINSGPQQSGLIVYKKRKLEEDAQDSDGDLKMEPKETEEAPLVEKAEELTDEQRAVNALLAAAKQGADGGDAEEMTLSAIHMPSSADWRQAKSEAEAYKEDVATRPDSASLEDYQRVPVSQFGTALLLGMGWKPGQGASKSGKGPVEAHAPKARPALLGLGAKPTDVVEDGKQKGGPKPSKKYIPVIAKGRDTSRDKRSGRDRSRSRDRRDRDRDRDRDRDYDRRDGRSGSHRRDDGRESERRSESGRDRARDDRYRDSSSRRDRDDSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.44
4 0.41
5 0.37
6 0.3
7 0.26
8 0.22
9 0.22
10 0.2
11 0.23
12 0.21
13 0.2
14 0.24
15 0.25
16 0.34
17 0.4
18 0.43
19 0.47
20 0.57
21 0.65
22 0.67
23 0.7
24 0.66
25 0.61
26 0.6
27 0.53
28 0.45
29 0.46
30 0.44
31 0.41
32 0.4
33 0.44
34 0.49
35 0.48
36 0.5
37 0.46
38 0.44
39 0.4
40 0.37
41 0.34
42 0.29
43 0.3
44 0.28
45 0.26
46 0.24
47 0.24
48 0.23
49 0.18
50 0.15
51 0.13
52 0.12
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.06
59 0.05
60 0.05
61 0.04
62 0.04
63 0.06
64 0.06
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.1
73 0.12
74 0.16
75 0.16
76 0.16
77 0.17
78 0.18
79 0.19
80 0.19
81 0.22
82 0.23
83 0.28
84 0.31
85 0.31
86 0.32
87 0.34
88 0.33
89 0.3
90 0.27
91 0.23
92 0.2
93 0.2
94 0.18
95 0.16
96 0.16
97 0.14
98 0.11
99 0.11
100 0.12
101 0.11
102 0.11
103 0.09
104 0.1
105 0.11
106 0.11
107 0.13
108 0.15
109 0.19
110 0.2
111 0.23
112 0.23
113 0.25
114 0.26
115 0.24
116 0.31
117 0.36
118 0.45
119 0.51
120 0.57
121 0.58
122 0.64
123 0.69
124 0.66
125 0.63
126 0.62
127 0.58
128 0.6
129 0.61
130 0.56
131 0.5
132 0.46
133 0.41
134 0.32
135 0.29
136 0.22
137 0.19
138 0.17
139 0.16
140 0.14
141 0.12
142 0.12
143 0.1
144 0.1
145 0.07
146 0.07
147 0.07
148 0.08
149 0.1
150 0.12
151 0.14
152 0.12
153 0.12
154 0.13
155 0.11
156 0.13
157 0.14
158 0.15
159 0.19
160 0.22
161 0.28
162 0.3
163 0.31
164 0.32
165 0.34
166 0.38
167 0.43
168 0.46
169 0.44
170 0.43
171 0.41
172 0.39
173 0.35
174 0.27
175 0.18
176 0.11
177 0.09
178 0.08
179 0.1
180 0.1
181 0.1
182 0.12
183 0.12
184 0.14
185 0.13
186 0.13
187 0.13
188 0.14
189 0.13
190 0.1
191 0.1
192 0.08
193 0.07
194 0.07
195 0.07
196 0.07
197 0.07
198 0.08
199 0.08
200 0.07
201 0.08
202 0.07
203 0.07
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.03
224 0.03
225 0.03
226 0.03
227 0.03
228 0.04
229 0.04
230 0.05
231 0.1
232 0.11
233 0.16
234 0.17
235 0.19
236 0.2
237 0.22
238 0.23
239 0.19
240 0.25
241 0.21
242 0.22
243 0.22
244 0.22
245 0.22
246 0.22
247 0.2
248 0.16
249 0.17
250 0.15
251 0.15
252 0.13
253 0.12
254 0.12
255 0.13
256 0.14
257 0.13
258 0.15
259 0.15
260 0.16
261 0.16
262 0.16
263 0.15
264 0.13
265 0.14
266 0.13
267 0.12
268 0.12
269 0.11
270 0.12
271 0.11
272 0.11
273 0.07
274 0.06
275 0.05
276 0.05
277 0.05
278 0.04
279 0.04
280 0.05
281 0.06
282 0.1
283 0.11
284 0.15
285 0.18
286 0.25
287 0.25
288 0.28
289 0.28
290 0.26
291 0.26
292 0.25
293 0.31
294 0.26
295 0.3
296 0.33
297 0.33
298 0.34
299 0.36
300 0.33
301 0.23
302 0.23
303 0.21
304 0.2
305 0.21
306 0.19
307 0.21
308 0.2
309 0.19
310 0.19
311 0.16
312 0.12
313 0.11
314 0.13
315 0.12
316 0.2
317 0.21
318 0.23
319 0.25
320 0.28
321 0.32
322 0.4
323 0.45
324 0.48
325 0.55
326 0.62
327 0.69
328 0.7
329 0.72
330 0.7
331 0.71
332 0.69
333 0.68
334 0.65
335 0.61
336 0.6
337 0.56
338 0.56
339 0.53
340 0.52
341 0.53
342 0.58
343 0.55
344 0.61
345 0.68
346 0.71
347 0.74
348 0.77
349 0.77
350 0.77
351 0.87
352 0.88
353 0.88
354 0.87
355 0.86
356 0.86
357 0.88
358 0.89
359 0.88
360 0.89
361 0.9
362 0.89
363 0.9
364 0.85
365 0.83
366 0.8
367 0.79
368 0.75
369 0.75
370 0.73
371 0.69
372 0.66
373 0.59
374 0.57
375 0.58
376 0.61
377 0.59
378 0.62
379 0.6
380 0.61
381 0.65
382 0.65
383 0.63
384 0.61
385 0.61
386 0.59
387 0.63
388 0.62
389 0.58
390 0.56
391 0.57
392 0.56
393 0.58
394 0.6
395 0.56
396 0.58
397 0.63
398 0.69
399 0.69
400 0.68
401 0.68
402 0.67
403 0.7
404 0.7
405 0.7
406 0.71
407 0.73
408 0.75
409 0.71
410 0.72