Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3A9S8

Protein Details
Accession A0A0C3A9S8   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-71IALRWQRSFRTRPRRPPSTKPRNLSIRSRHydrophilic
NLS Segment(s)
PositionSequence
52-69RTRPRRPPSTKPRNLSIR
Subcellular Location(s) plas 11, mito 6, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPEPTCREAASSVTGYRSALDSESGIIVTNSVVLCHVMLFCGIALRWQRSFRTRPRRPPSTKPRNLSIRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.18
4 0.16
5 0.12
6 0.11
7 0.1
8 0.09
9 0.09
10 0.09
11 0.08
12 0.07
13 0.06
14 0.06
15 0.05
16 0.06
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.03
25 0.03
26 0.04
27 0.03
28 0.04
29 0.04
30 0.07
31 0.1
32 0.13
33 0.16
34 0.19
35 0.23
36 0.29
37 0.37
38 0.44
39 0.53
40 0.6
41 0.68
42 0.75
43 0.82
44 0.84
45 0.87
46 0.88
47 0.88
48 0.88
49 0.83
50 0.83
51 0.82