Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WTD6

Protein Details
Accession A0A0C2WTD6    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
53-72LQPKRERVSRKCSRHQRGTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MCLSRSTFKTVLKHALNALVFPPGERHRTLCYSAWVKHATDKLVPGAEAAVLLQPKRERVSRKCSRHQRGTCGRRWIPLWHPQTTTHRPSRQLRVHFDPQRSTLNPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.38
4 0.33
5 0.28
6 0.21
7 0.19
8 0.17
9 0.2
10 0.18
11 0.21
12 0.21
13 0.24
14 0.25
15 0.29
16 0.33
17 0.29
18 0.33
19 0.34
20 0.35
21 0.37
22 0.34
23 0.31
24 0.32
25 0.33
26 0.28
27 0.24
28 0.23
29 0.2
30 0.18
31 0.18
32 0.13
33 0.11
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.07
41 0.08
42 0.1
43 0.12
44 0.16
45 0.22
46 0.28
47 0.39
48 0.47
49 0.55
50 0.64
51 0.73
52 0.77
53 0.81
54 0.79
55 0.79
56 0.8
57 0.79
58 0.76
59 0.75
60 0.67
61 0.6
62 0.58
63 0.53
64 0.48
65 0.5
66 0.48
67 0.42
68 0.43
69 0.45
70 0.51
71 0.54
72 0.56
73 0.56
74 0.56
75 0.6
76 0.65
77 0.7
78 0.7
79 0.7
80 0.7
81 0.69
82 0.75
83 0.74
84 0.73
85 0.68
86 0.63
87 0.63