Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2WPV3

Protein Details
Accession A0A0C2WPV3   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-47TTQFNAAPRRSRRQKKDNKAQSQHTNVHydrophilic
66-88DYEPAKAKKRKGKQKAEPAMEKRBasic
NLS Segment(s)
PositionSequence
31-33SRR
70-93AKAKKRKGKQKAEPAMEKRLAIFK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAPKRKANDELPFDPSDIPTTTQFNAAPRRSRRQKKDNKAQSQHTNVDENGPDEASNKELKDEGVDYEPAKAKKRKGKQKAEPAMEKRLAIFKKKCPQIIQERVERVKQQRFYMIGRERLNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.3
4 0.23
5 0.22
6 0.18
7 0.2
8 0.2
9 0.22
10 0.22
11 0.25
12 0.32
13 0.34
14 0.41
15 0.44
16 0.54
17 0.62
18 0.71
19 0.76
20 0.78
21 0.84
22 0.87
23 0.92
24 0.92
25 0.92
26 0.89
27 0.87
28 0.84
29 0.8
30 0.73
31 0.64
32 0.56
33 0.45
34 0.4
35 0.32
36 0.25
37 0.18
38 0.14
39 0.11
40 0.1
41 0.1
42 0.09
43 0.1
44 0.09
45 0.09
46 0.09
47 0.09
48 0.1
49 0.1
50 0.09
51 0.09
52 0.1
53 0.1
54 0.12
55 0.16
56 0.17
57 0.23
58 0.26
59 0.31
60 0.4
61 0.5
62 0.58
63 0.65
64 0.74
65 0.77
66 0.85
67 0.87
68 0.85
69 0.85
70 0.78
71 0.76
72 0.66
73 0.56
74 0.46
75 0.45
76 0.4
77 0.39
78 0.4
79 0.42
80 0.5
81 0.56
82 0.6
83 0.56
84 0.61
85 0.63
86 0.68
87 0.65
88 0.64
89 0.66
90 0.65
91 0.65
92 0.64
93 0.61
94 0.6
95 0.6
96 0.55
97 0.54
98 0.54
99 0.53
100 0.56
101 0.55
102 0.55