Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z6R0

Protein Details
Accession A0A0C9Z6R0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
96-118RPSSTRRKSQSRTKRSSRRDGEPBasic
NLS Segment(s)
PositionSequence
82-119RGRSKKRARSQSESRPSSTRRKSQSRTKRSSRRDGEPK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.333, mito_nucl 12.332, cyto 4
Family & Domain DBs
Amino Acid Sequences SPTADPVLVRVPTTPEPENRPVSNVAPSHPVSVDKGKGKALPAESQAIEQERTTQGDVNEDGESEVVEPDVQMDEETSEPVRGRSKKRARSQSESRPSSTRRKSQSRTKRSSRRDGEPKGEGMSAPSDPPTTPKPKYGRAQVAARTTPPPDPHTCRTCINRKVVCTWTVGNIPCDPCKKRKIGCGKGNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.39
4 0.45
5 0.5
6 0.45
7 0.45
8 0.42
9 0.4
10 0.42
11 0.36
12 0.31
13 0.31
14 0.31
15 0.3
16 0.27
17 0.26
18 0.24
19 0.28
20 0.32
21 0.3
22 0.31
23 0.31
24 0.33
25 0.33
26 0.34
27 0.32
28 0.3
29 0.28
30 0.3
31 0.28
32 0.26
33 0.27
34 0.24
35 0.21
36 0.17
37 0.18
38 0.15
39 0.17
40 0.17
41 0.17
42 0.15
43 0.18
44 0.18
45 0.17
46 0.15
47 0.13
48 0.13
49 0.1
50 0.1
51 0.07
52 0.06
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.04
60 0.04
61 0.05
62 0.05
63 0.07
64 0.06
65 0.07
66 0.07
67 0.09
68 0.15
69 0.2
70 0.25
71 0.35
72 0.44
73 0.52
74 0.62
75 0.71
76 0.71
77 0.75
78 0.78
79 0.78
80 0.79
81 0.72
82 0.66
83 0.6
84 0.57
85 0.58
86 0.56
87 0.52
88 0.5
89 0.57
90 0.61
91 0.67
92 0.74
93 0.75
94 0.77
95 0.8
96 0.82
97 0.81
98 0.85
99 0.8
100 0.79
101 0.78
102 0.75
103 0.7
104 0.63
105 0.56
106 0.47
107 0.42
108 0.32
109 0.23
110 0.19
111 0.14
112 0.11
113 0.11
114 0.1
115 0.1
116 0.13
117 0.18
118 0.23
119 0.25
120 0.32
121 0.37
122 0.44
123 0.51
124 0.56
125 0.59
126 0.58
127 0.62
128 0.6
129 0.61
130 0.55
131 0.51
132 0.44
133 0.37
134 0.36
135 0.34
136 0.33
137 0.34
138 0.4
139 0.45
140 0.47
141 0.49
142 0.51
143 0.56
144 0.6
145 0.6
146 0.63
147 0.61
148 0.59
149 0.62
150 0.6
151 0.53
152 0.47
153 0.41
154 0.36
155 0.36
156 0.35
157 0.32
158 0.32
159 0.34
160 0.36
161 0.42
162 0.43
163 0.45
164 0.51
165 0.57
166 0.59
167 0.65
168 0.71
169 0.74