Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YRP5

Protein Details
Accession A0A0C9YRP5    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-100TRGCGMDQRKQKPRHWYPRCDKLQKPAKPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6, cyto 4, extr 2
Family & Domain DBs
Amino Acid Sequences MPVARDVRLLMIPGQVEYRSSSAAADLECCWLASGLVRKLTGTDFSRISQASSRSAHFLWVCLGSHDQNQGTRGCGMDQRKQKPRHWYPRCDKLQKPAKPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.14
4 0.15
5 0.15
6 0.13
7 0.13
8 0.12
9 0.11
10 0.12
11 0.11
12 0.11
13 0.1
14 0.11
15 0.1
16 0.1
17 0.1
18 0.08
19 0.08
20 0.09
21 0.14
22 0.15
23 0.17
24 0.17
25 0.17
26 0.17
27 0.18
28 0.2
29 0.17
30 0.17
31 0.16
32 0.17
33 0.19
34 0.18
35 0.18
36 0.16
37 0.16
38 0.17
39 0.17
40 0.17
41 0.18
42 0.18
43 0.2
44 0.17
45 0.16
46 0.13
47 0.13
48 0.13
49 0.12
50 0.13
51 0.12
52 0.14
53 0.16
54 0.16
55 0.16
56 0.18
57 0.17
58 0.17
59 0.17
60 0.15
61 0.14
62 0.19
63 0.22
64 0.28
65 0.37
66 0.45
67 0.54
68 0.61
69 0.66
70 0.71
71 0.77
72 0.81
73 0.81
74 0.83
75 0.83
76 0.87
77 0.91
78 0.88
79 0.82
80 0.81
81 0.82