Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BPA2

Protein Details
Accession Q6BPA2   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
135-163ATWPKADTSKSKQRLKKRKQNNLSNLLALHydrophilic
NLS Segment(s)
PositionSequence
143-153SKSKQRLKKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG dha:DEHA2E15246g  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MDKLTNNQITSIHLQNLSHSVPLNPLAKVYKDTFREFTQDKCINLPANYMEDIFCDKCESIYIPGITVSIRIIYNRKKTNAVSRRRLLRYTCLECDHKSDRVLEMPTSKQSTPIPNIGSDTGGRNKTTKPEEFKATWPKADTSKSKQRLKKRKQNNLSNLLALKKKEKENESKQFNSLSLMEFMNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.3
4 0.26
5 0.23
6 0.2
7 0.17
8 0.17
9 0.23
10 0.23
11 0.19
12 0.2
13 0.21
14 0.22
15 0.26
16 0.27
17 0.29
18 0.31
19 0.36
20 0.37
21 0.36
22 0.41
23 0.39
24 0.38
25 0.41
26 0.4
27 0.37
28 0.35
29 0.37
30 0.33
31 0.32
32 0.31
33 0.23
34 0.21
35 0.21
36 0.19
37 0.16
38 0.13
39 0.17
40 0.15
41 0.14
42 0.13
43 0.12
44 0.12
45 0.13
46 0.13
47 0.12
48 0.16
49 0.15
50 0.14
51 0.14
52 0.14
53 0.13
54 0.11
55 0.09
56 0.06
57 0.07
58 0.08
59 0.13
60 0.2
61 0.28
62 0.33
63 0.35
64 0.37
65 0.39
66 0.49
67 0.52
68 0.55
69 0.55
70 0.56
71 0.62
72 0.61
73 0.63
74 0.54
75 0.52
76 0.51
77 0.47
78 0.44
79 0.39
80 0.39
81 0.36
82 0.4
83 0.35
84 0.3
85 0.26
86 0.24
87 0.21
88 0.22
89 0.22
90 0.18
91 0.18
92 0.17
93 0.19
94 0.22
95 0.2
96 0.2
97 0.21
98 0.25
99 0.25
100 0.28
101 0.26
102 0.23
103 0.25
104 0.23
105 0.22
106 0.17
107 0.18
108 0.19
109 0.19
110 0.2
111 0.2
112 0.2
113 0.26
114 0.32
115 0.34
116 0.37
117 0.39
118 0.45
119 0.45
120 0.52
121 0.55
122 0.52
123 0.49
124 0.43
125 0.41
126 0.4
127 0.44
128 0.44
129 0.43
130 0.5
131 0.57
132 0.64
133 0.7
134 0.76
135 0.81
136 0.85
137 0.86
138 0.87
139 0.89
140 0.9
141 0.93
142 0.92
143 0.89
144 0.81
145 0.75
146 0.66
147 0.6
148 0.54
149 0.45
150 0.43
151 0.41
152 0.44
153 0.48
154 0.53
155 0.59
156 0.65
157 0.73
158 0.75
159 0.72
160 0.68
161 0.62
162 0.55
163 0.48
164 0.39
165 0.31
166 0.25