Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YR99

Protein Details
Accession A0A0C9YR99    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-94GEVVGKPRKKRSDMGRKRRRBasic
NLS Segment(s)
PositionSequence
79-94GKPRKKRSDMGRKRRR
Subcellular Location(s) cyto 9, nucl 8, pero 6, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences INFINFEVAIKEKYGIDLRGWPEGVPFQSPHAITSAEHLRTLRDALKAGTCHWAYMSRQQRLEYQDRLKEWRSAGEVVGKPRKKRSDMGRKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.23
5 0.25
6 0.27
7 0.27
8 0.24
9 0.21
10 0.23
11 0.22
12 0.18
13 0.17
14 0.15
15 0.18
16 0.19
17 0.18
18 0.16
19 0.16
20 0.13
21 0.17
22 0.21
23 0.17
24 0.18
25 0.18
26 0.17
27 0.17
28 0.19
29 0.17
30 0.12
31 0.12
32 0.12
33 0.15
34 0.15
35 0.15
36 0.19
37 0.16
38 0.15
39 0.15
40 0.18
41 0.16
42 0.25
43 0.33
44 0.31
45 0.33
46 0.35
47 0.39
48 0.42
49 0.46
50 0.45
51 0.43
52 0.43
53 0.44
54 0.48
55 0.46
56 0.43
57 0.39
58 0.35
59 0.32
60 0.29
61 0.27
62 0.31
63 0.32
64 0.36
65 0.45
66 0.46
67 0.48
68 0.56
69 0.63
70 0.59
71 0.64
72 0.67
73 0.69
74 0.75