Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YET2

Protein Details
Accession A0A0C9YET2    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-58AESSEPKPKRGRGRPKGSKNKKSGAPBasic
112-138ADADERPAKRRRRGRPPKQPKDDGPAABasic
NLS Segment(s)
PositionSequence
38-60PKPKRGRGRPKGSKNKKSGAPSS
69-82PETPIKKKRGRPRK
117-132RPAKRRRRGRPPKQPK
155-166TKKKRGRPPKKT
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPQPDDPADRYDEGNPENDQHNPEEAEGVAESSEPKPKRGRGRPKGSKNKKSGAPSSSTAPAVSSPETPIKKKRGRPRKVFISCTNTLTLILILPTQHHTLQEKKSEEADADERPAKRRRRGRPPKQPKDDGPAAAGSSSAAPVETAGESATKKKRGRPPKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.28
4 0.28
5 0.26
6 0.24
7 0.25
8 0.26
9 0.25
10 0.22
11 0.24
12 0.22
13 0.21
14 0.19
15 0.17
16 0.15
17 0.13
18 0.11
19 0.08
20 0.07
21 0.09
22 0.09
23 0.17
24 0.17
25 0.21
26 0.26
27 0.34
28 0.44
29 0.53
30 0.63
31 0.66
32 0.77
33 0.84
34 0.89
35 0.93
36 0.93
37 0.92
38 0.88
39 0.85
40 0.8
41 0.76
42 0.71
43 0.63
44 0.57
45 0.49
46 0.45
47 0.4
48 0.34
49 0.27
50 0.21
51 0.18
52 0.15
53 0.14
54 0.12
55 0.11
56 0.17
57 0.2
58 0.22
59 0.28
60 0.36
61 0.42
62 0.49
63 0.57
64 0.62
65 0.69
66 0.76
67 0.78
68 0.8
69 0.8
70 0.78
71 0.73
72 0.7
73 0.62
74 0.54
75 0.46
76 0.35
77 0.28
78 0.22
79 0.16
80 0.09
81 0.07
82 0.05
83 0.05
84 0.05
85 0.08
86 0.09
87 0.1
88 0.12
89 0.14
90 0.2
91 0.24
92 0.31
93 0.31
94 0.3
95 0.31
96 0.3
97 0.28
98 0.26
99 0.24
100 0.18
101 0.2
102 0.23
103 0.23
104 0.28
105 0.36
106 0.4
107 0.46
108 0.54
109 0.61
110 0.68
111 0.79
112 0.84
113 0.88
114 0.92
115 0.93
116 0.93
117 0.91
118 0.85
119 0.82
120 0.77
121 0.67
122 0.57
123 0.48
124 0.38
125 0.3
126 0.25
127 0.16
128 0.11
129 0.1
130 0.07
131 0.06
132 0.05
133 0.05
134 0.07
135 0.07
136 0.07
137 0.07
138 0.09
139 0.1
140 0.18
141 0.26
142 0.33
143 0.37
144 0.46
145 0.56
146 0.65