Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZXH0

Protein Details
Accession A0A0C9ZXH0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-40GSKTSKVCKEKWKRLRKTFKVIDCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 10, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences SFWNAVSNALSNPSKGGSKTSKVCKEKWKRLRKTFKVIDCIKNTSGFAYSHELGANIGLENEAVWNGFIKVCAYIKNANLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.24
4 0.24
5 0.3
6 0.37
7 0.46
8 0.54
9 0.55
10 0.61
11 0.65
12 0.7
13 0.75
14 0.78
15 0.79
16 0.8
17 0.86
18 0.92
19 0.88
20 0.88
21 0.85
22 0.8
23 0.78
24 0.73
25 0.69
26 0.61
27 0.57
28 0.48
29 0.41
30 0.35
31 0.27
32 0.23
33 0.16
34 0.15
35 0.17
36 0.16
37 0.16
38 0.16
39 0.15
40 0.13
41 0.13
42 0.11
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.06
54 0.06
55 0.07
56 0.08
57 0.11
58 0.12
59 0.15
60 0.18
61 0.23