Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZV42

Protein Details
Accession A0A0C9ZV42   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-52GEQRCKHVTRERQHKLRRPRKRRVLRPLGRRWPWDBasic
NLS Segment(s)
PositionSequence
28-48ERQHKLRRPRKRRVLRPLGRR
Subcellular Location(s) mito 14, nucl 7, pero 3, cyto 1, plas 1, extr 1
Family & Domain DBs
Amino Acid Sequences MRQELFAGVLGGTCPRNGEQRCKHVTRERQHKLRRPRKRRVLRPLGRRWPWDAQRQAAANRVYFSDHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.19
4 0.22
5 0.32
6 0.37
7 0.46
8 0.53
9 0.54
10 0.59
11 0.6
12 0.66
13 0.66
14 0.7
15 0.7
16 0.73
17 0.79
18 0.81
19 0.83
20 0.84
21 0.86
22 0.84
23 0.86
24 0.87
25 0.89
26 0.91
27 0.9
28 0.91
29 0.89
30 0.9
31 0.9
32 0.89
33 0.83
34 0.76
35 0.71
36 0.69
37 0.66
38 0.66
39 0.6
40 0.54
41 0.54
42 0.55
43 0.52
44 0.49
45 0.46
46 0.38
47 0.34
48 0.31