Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9YXF8

Protein Details
Accession A0A0C9YXF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49PKTAKACKERWQRMKKTFDVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences KASASDGLNFKMTFWNTAAAQLPGPTKGAPKTAKACKERWQRMKKTFDVVDHIANASGFTYLHESGASIGLENEGVWTDFVKKNKHASPFQNKGWPHYEKMKLLMPSKGKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.21
4 0.24
5 0.25
6 0.19
7 0.18
8 0.18
9 0.18
10 0.15
11 0.16
12 0.14
13 0.15
14 0.16
15 0.23
16 0.23
17 0.27
18 0.35
19 0.41
20 0.49
21 0.51
22 0.53
23 0.55
24 0.64
25 0.69
26 0.71
27 0.73
28 0.74
29 0.79
30 0.82
31 0.75
32 0.71
33 0.63
34 0.54
35 0.5
36 0.42
37 0.34
38 0.27
39 0.25
40 0.18
41 0.15
42 0.13
43 0.07
44 0.06
45 0.04
46 0.04
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.09
54 0.08
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.09
66 0.13
67 0.18
68 0.22
69 0.26
70 0.33
71 0.38
72 0.45
73 0.48
74 0.54
75 0.61
76 0.64
77 0.65
78 0.66
79 0.61
80 0.59
81 0.59
82 0.53
83 0.48
84 0.49
85 0.51
86 0.46
87 0.49
88 0.5
89 0.49
90 0.49
91 0.51
92 0.47
93 0.43