Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YV25

Protein Details
Accession A0A0C9YV25   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-31CLCSLKPSSRTSRRRNRFNGSHLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MACEVQAICLCSLKPSSRTSRRRNRFNGSHLGSIRYTTWSQFGGSRRGFSTSTSGRVVSSSQII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.36
4 0.45
5 0.55
6 0.63
7 0.71
8 0.77
9 0.83
10 0.85
11 0.84
12 0.8
13 0.76
14 0.75
15 0.68
16 0.64
17 0.54
18 0.49
19 0.39
20 0.33
21 0.28
22 0.21
23 0.18
24 0.13
25 0.14
26 0.12
27 0.13
28 0.17
29 0.19
30 0.24
31 0.25
32 0.26
33 0.26
34 0.28
35 0.28
36 0.25
37 0.3
38 0.26
39 0.29
40 0.29
41 0.28
42 0.25
43 0.26
44 0.25