Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z0I0

Protein Details
Accession A0A0C9Z0I0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-44PTFQYLPKNRAKKLRRSWVDSKKLKSQWRAQKKREGIHydrophilic
NLS Segment(s)
PositionSequence
15-41KNRAKKLRRSWVDSKKLKSQWRAQKKR
Subcellular Location(s) nucl 22, cyto_nucl 13.333, mito_nucl 12.999
Family & Domain DBs
Amino Acid Sequences MTGPERKPTFQYLPKNRAKKLRRSWVDSKKLKSQWRAQKKREGIWSKSSSQPDNHECEMVTQTYPDGTSDLPVDSDNKATDDILPEDQHSTQASTTNKVSLRELKRQAYSPSTLHNHKSDSRKRRGADTLSPHSTSKNPSGHSKGQPNMKLRMNAMLEKIKRDLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.78
4 0.8
5 0.79
6 0.79
7 0.79
8 0.81
9 0.79
10 0.8
11 0.84
12 0.85
13 0.87
14 0.84
15 0.79
16 0.78
17 0.77
18 0.77
19 0.74
20 0.73
21 0.74
22 0.77
23 0.82
24 0.79
25 0.81
26 0.79
27 0.78
28 0.78
29 0.75
30 0.69
31 0.68
32 0.66
33 0.59
34 0.6
35 0.57
36 0.49
37 0.45
38 0.47
39 0.42
40 0.43
41 0.4
42 0.34
43 0.3
44 0.29
45 0.27
46 0.21
47 0.16
48 0.1
49 0.1
50 0.09
51 0.09
52 0.08
53 0.07
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.11
74 0.11
75 0.11
76 0.1
77 0.09
78 0.08
79 0.13
80 0.13
81 0.15
82 0.15
83 0.19
84 0.2
85 0.2
86 0.23
87 0.27
88 0.31
89 0.37
90 0.43
91 0.43
92 0.44
93 0.46
94 0.47
95 0.42
96 0.4
97 0.32
98 0.33
99 0.34
100 0.35
101 0.36
102 0.35
103 0.35
104 0.38
105 0.47
106 0.5
107 0.55
108 0.61
109 0.65
110 0.64
111 0.67
112 0.68
113 0.64
114 0.63
115 0.62
116 0.6
117 0.57
118 0.58
119 0.51
120 0.46
121 0.43
122 0.39
123 0.38
124 0.36
125 0.34
126 0.4
127 0.47
128 0.53
129 0.58
130 0.61
131 0.6
132 0.63
133 0.67
134 0.64
135 0.64
136 0.62
137 0.58
138 0.51
139 0.53
140 0.48
141 0.44
142 0.45
143 0.47
144 0.43
145 0.43