Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9D4I7

Protein Details
Accession E9D4I7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
69-89LRKLNPDTKKNWKNRKGATALHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11extr 11, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHFIPLASGIVSSGFLDPGATKGREQGCRLLITYDSAKAPAGGFVLSISGIFLVVASKCVFLKMGDRVLRKLNPDTKKNWKNRKGATALKHVSPRTCFLNSYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.07
5 0.09
6 0.14
7 0.14
8 0.13
9 0.2
10 0.26
11 0.31
12 0.33
13 0.36
14 0.34
15 0.34
16 0.35
17 0.3
18 0.24
19 0.22
20 0.21
21 0.17
22 0.14
23 0.13
24 0.13
25 0.12
26 0.11
27 0.09
28 0.08
29 0.06
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.03
41 0.03
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.1
50 0.12
51 0.19
52 0.24
53 0.26
54 0.28
55 0.33
56 0.35
57 0.35
58 0.39
59 0.41
60 0.44
61 0.47
62 0.52
63 0.58
64 0.65
65 0.72
66 0.75
67 0.76
68 0.78
69 0.8
70 0.82
71 0.79
72 0.78
73 0.74
74 0.73
75 0.68
76 0.64
77 0.64
78 0.57
79 0.55
80 0.5
81 0.47
82 0.42
83 0.41