Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A9Q8

Protein Details
Accession A0A0D0A9Q8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-45RIPLTGFEPRRKRRRWQYQCMLMDVHydrophilic
NLS Segment(s)
PositionSequence
31-33RKR
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MARYIRTSRYSIHGFRSFISRIPLTGFEPRRKRRRWQYQCMLMDVYGNGAFLVEGMPRAACCIRFLQCALRLKQPVAEETDRDGKCDEATGNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.44
4 0.38
5 0.33
6 0.35
7 0.27
8 0.22
9 0.23
10 0.24
11 0.22
12 0.29
13 0.33
14 0.37
15 0.46
16 0.55
17 0.62
18 0.65
19 0.72
20 0.75
21 0.81
22 0.82
23 0.83
24 0.83
25 0.84
26 0.8
27 0.72
28 0.62
29 0.5
30 0.4
31 0.29
32 0.2
33 0.1
34 0.08
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.06
46 0.07
47 0.07
48 0.09
49 0.12
50 0.14
51 0.16
52 0.18
53 0.22
54 0.27
55 0.34
56 0.35
57 0.39
58 0.39
59 0.38
60 0.41
61 0.37
62 0.33
63 0.33
64 0.33
65 0.27
66 0.3
67 0.39
68 0.35
69 0.35
70 0.34
71 0.27
72 0.25
73 0.26