Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZH09

Protein Details
Accession A0A0C9ZH09    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23SGRQGKKRKKRKGKLMGDGLPRLBasic
NLS Segment(s)
PositionSequence
4-14QGKKRKKRKGK
Subcellular Location(s) mito 13.5, nucl 13, cyto_mito 7.5
Family & Domain DBs
Amino Acid Sequences SGRQGKKRKKRKGKLMGDGLPRLLTGEAFYNRVVEFENAAAEEEVQRENQRKQKESQAEALGAWKVADKEWQQCNKACNETYKTELGNWKAERELA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.89
4 0.84
5 0.75
6 0.65
7 0.54
8 0.43
9 0.33
10 0.23
11 0.15
12 0.09
13 0.12
14 0.13
15 0.14
16 0.14
17 0.14
18 0.14
19 0.14
20 0.15
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.07
32 0.07
33 0.09
34 0.12
35 0.16
36 0.22
37 0.26
38 0.28
39 0.31
40 0.39
41 0.44
42 0.44
43 0.45
44 0.42
45 0.37
46 0.34
47 0.33
48 0.24
49 0.17
50 0.14
51 0.1
52 0.08
53 0.08
54 0.13
55 0.14
56 0.21
57 0.3
58 0.37
59 0.39
60 0.42
61 0.45
62 0.46
63 0.49
64 0.44
65 0.43
66 0.42
67 0.42
68 0.43
69 0.43
70 0.38
71 0.38
72 0.42
73 0.39
74 0.42
75 0.4
76 0.38