Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YYW4

Protein Details
Accession A0A0C9YYW4    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MIGPIKIEERKRKRYSFQKIISKSVRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 6, cyto 4.5, cysk 4
Family & Domain DBs
Amino Acid Sequences MIGPIKIEERKRKRYSFQKIISKSVRELWRMVTGGQGSIPVASIRRDATVIGCRRYMLAAVLQRNASPSSDTVMVLVGHDTTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.83
4 0.83
5 0.83
6 0.79
7 0.8
8 0.76
9 0.68
10 0.59
11 0.56
12 0.52
13 0.43
14 0.4
15 0.34
16 0.33
17 0.31
18 0.28
19 0.23
20 0.18
21 0.16
22 0.15
23 0.12
24 0.08
25 0.07
26 0.07
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.1
36 0.18
37 0.21
38 0.22
39 0.21
40 0.21
41 0.21
42 0.21
43 0.19
44 0.12
45 0.14
46 0.18
47 0.2
48 0.22
49 0.22
50 0.22
51 0.23
52 0.23
53 0.19
54 0.15
55 0.14
56 0.15
57 0.16
58 0.16
59 0.14
60 0.15
61 0.14
62 0.12
63 0.12