Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E9D8C6

Protein Details
Accession E9D8C6    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-110DSVSPSKRMTRSRRPLKPKQEVEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038872  Put_GTT3  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTAALPYLRALRKSDLLVLAEVSDLKDYDDYKKPELEAALDEHLSANRTTLSKEQRLSDYYRRLLQPPRSSPIKREPKPDGPSGLDDSVSPSKRMTRSRRPLKPKQEVEATDESESGSASQASRSPSASAMEAHTPSRPALGFLSSLPPSPAVVTEAIEEQTTKVRKSVSDAWVASGLKERAYALRSCLSSVSTIESLILMLEIYGLGSEILPFRYLTTIPPMPNLYTPAIQVKIPDVFALLTGEFWAPFSLWLTTSVILPSIFAYFFNISLKMSQPQPPSHSYGTRRASAAQAAVASSKTNFDPLVFNVSKALVSYLVYANKFTFWDVYNPISVRKVSDSVPGGLPGLLTGSALCVLGSLYEAILRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.34
4 0.32
5 0.29
6 0.24
7 0.21
8 0.19
9 0.14
10 0.11
11 0.09
12 0.1
13 0.12
14 0.13
15 0.19
16 0.27
17 0.31
18 0.33
19 0.36
20 0.36
21 0.37
22 0.36
23 0.32
24 0.26
25 0.25
26 0.25
27 0.22
28 0.21
29 0.19
30 0.18
31 0.18
32 0.15
33 0.12
34 0.12
35 0.13
36 0.15
37 0.22
38 0.3
39 0.35
40 0.38
41 0.41
42 0.43
43 0.46
44 0.51
45 0.52
46 0.52
47 0.49
48 0.53
49 0.52
50 0.52
51 0.57
52 0.59
53 0.6
54 0.58
55 0.6
56 0.62
57 0.62
58 0.63
59 0.65
60 0.67
61 0.62
62 0.64
63 0.66
64 0.67
65 0.7
66 0.68
67 0.62
68 0.54
69 0.54
70 0.5
71 0.42
72 0.32
73 0.27
74 0.28
75 0.3
76 0.28
77 0.25
78 0.21
79 0.27
80 0.33
81 0.42
82 0.46
83 0.5
84 0.6
85 0.7
86 0.79
87 0.83
88 0.87
89 0.89
90 0.9
91 0.84
92 0.79
93 0.77
94 0.69
95 0.66
96 0.6
97 0.51
98 0.41
99 0.35
100 0.29
101 0.21
102 0.19
103 0.13
104 0.08
105 0.06
106 0.06
107 0.07
108 0.1
109 0.12
110 0.13
111 0.14
112 0.14
113 0.15
114 0.16
115 0.16
116 0.14
117 0.13
118 0.15
119 0.15
120 0.15
121 0.15
122 0.15
123 0.14
124 0.15
125 0.13
126 0.11
127 0.1
128 0.11
129 0.11
130 0.1
131 0.15
132 0.13
133 0.13
134 0.12
135 0.12
136 0.11
137 0.1
138 0.1
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.08
147 0.07
148 0.12
149 0.13
150 0.13
151 0.13
152 0.14
153 0.14
154 0.2
155 0.28
156 0.26
157 0.3
158 0.3
159 0.3
160 0.32
161 0.32
162 0.26
163 0.22
164 0.19
165 0.13
166 0.13
167 0.12
168 0.11
169 0.13
170 0.14
171 0.12
172 0.15
173 0.15
174 0.15
175 0.15
176 0.14
177 0.12
178 0.12
179 0.12
180 0.09
181 0.09
182 0.08
183 0.08
184 0.07
185 0.06
186 0.05
187 0.03
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.02
194 0.02
195 0.02
196 0.03
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.07
203 0.07
204 0.08
205 0.14
206 0.17
207 0.17
208 0.19
209 0.2
210 0.2
211 0.2
212 0.22
213 0.18
214 0.15
215 0.16
216 0.17
217 0.16
218 0.16
219 0.15
220 0.14
221 0.14
222 0.13
223 0.12
224 0.09
225 0.08
226 0.09
227 0.09
228 0.07
229 0.06
230 0.06
231 0.07
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.07
238 0.07
239 0.07
240 0.09
241 0.1
242 0.1
243 0.11
244 0.11
245 0.1
246 0.09
247 0.09
248 0.08
249 0.08
250 0.07
251 0.07
252 0.1
253 0.1
254 0.11
255 0.12
256 0.12
257 0.11
258 0.12
259 0.14
260 0.14
261 0.17
262 0.23
263 0.26
264 0.3
265 0.34
266 0.37
267 0.4
268 0.42
269 0.45
270 0.44
271 0.49
272 0.49
273 0.47
274 0.44
275 0.4
276 0.39
277 0.34
278 0.3
279 0.21
280 0.17
281 0.15
282 0.15
283 0.13
284 0.12
285 0.1
286 0.11
287 0.1
288 0.12
289 0.11
290 0.12
291 0.14
292 0.15
293 0.24
294 0.22
295 0.22
296 0.22
297 0.22
298 0.21
299 0.18
300 0.18
301 0.09
302 0.09
303 0.12
304 0.15
305 0.19
306 0.19
307 0.2
308 0.2
309 0.2
310 0.2
311 0.19
312 0.17
313 0.15
314 0.19
315 0.21
316 0.23
317 0.27
318 0.27
319 0.29
320 0.3
321 0.28
322 0.27
323 0.27
324 0.27
325 0.23
326 0.3
327 0.31
328 0.31
329 0.31
330 0.29
331 0.26
332 0.23
333 0.22
334 0.14
335 0.12
336 0.09
337 0.07
338 0.06
339 0.07
340 0.07
341 0.07
342 0.07
343 0.06
344 0.06
345 0.06
346 0.07
347 0.06
348 0.06