Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YZU1

Protein Details
Accession A0A0C9YZU1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-36IEEHSRRTRSDKGKKRTNHSSTTHydrophilic
NLS Segment(s)
PositionSequence
22-29RSDKGKKR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGAGRNEGLENGEIEEHSRRTRSDKGKKRTNHSSTTASKKKYKSAATVNDEDDEESGEPHDNASASLQPAHVQASTEVINDTNPTEQTSTAVNTRPIPQTITHNSNISPAAHSANIQGTPGPHPDTDDMEGIEQQEFLDNFADTILDFDAALGTPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.19
5 0.21
6 0.21
7 0.26
8 0.36
9 0.45
10 0.52
11 0.6
12 0.67
13 0.75
14 0.81
15 0.84
16 0.85
17 0.81
18 0.78
19 0.73
20 0.71
21 0.68
22 0.71
23 0.69
24 0.64
25 0.64
26 0.6
27 0.61
28 0.61
29 0.58
30 0.55
31 0.57
32 0.61
33 0.6
34 0.61
35 0.55
36 0.48
37 0.44
38 0.36
39 0.27
40 0.19
41 0.12
42 0.09
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.07
51 0.08
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.09
58 0.08
59 0.07
60 0.07
61 0.08
62 0.09
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.08
69 0.06
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.1
77 0.11
78 0.13
79 0.14
80 0.14
81 0.18
82 0.19
83 0.19
84 0.19
85 0.19
86 0.24
87 0.28
88 0.32
89 0.3
90 0.3
91 0.29
92 0.29
93 0.29
94 0.23
95 0.18
96 0.14
97 0.14
98 0.13
99 0.13
100 0.13
101 0.14
102 0.13
103 0.12
104 0.12
105 0.11
106 0.13
107 0.16
108 0.17
109 0.15
110 0.17
111 0.19
112 0.22
113 0.23
114 0.22
115 0.19
116 0.18
117 0.18
118 0.17
119 0.15
120 0.11
121 0.09
122 0.12
123 0.11
124 0.12
125 0.12
126 0.11
127 0.11
128 0.11
129 0.11
130 0.06
131 0.08
132 0.07
133 0.06
134 0.06
135 0.06
136 0.07