Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZLI8

Protein Details
Accession A0A0C9ZLI8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-34APSSGGKAAKKKKWSKGKVKDKAQHSVHydrophilic
NLS Segment(s)
PositionSequence
4-29AKAPAPSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAPAPSSGGKAAKKKKWSKGKVKDKAQHSVVLDKPTYDRIMKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGMIKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.57
4 0.64
5 0.7
6 0.72
7 0.77
8 0.82
9 0.84
10 0.86
11 0.9
12 0.89
13 0.91
14 0.88
15 0.82
16 0.8
17 0.71
18 0.64
19 0.54
20 0.51
21 0.43
22 0.39
23 0.34
24 0.26
25 0.25
26 0.22
27 0.22
28 0.17
29 0.14
30 0.14
31 0.17
32 0.18
33 0.21
34 0.25
35 0.24
36 0.27
37 0.29
38 0.26
39 0.26
40 0.25
41 0.24
42 0.2
43 0.21
44 0.18
45 0.21
46 0.2
47 0.19
48 0.19
49 0.17
50 0.16
51 0.15
52 0.15
53 0.14
54 0.15
55 0.16
56 0.16
57 0.16
58 0.15
59 0.16
60 0.22
61 0.22
62 0.22
63 0.22
64 0.24
65 0.22