Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9XL88

Protein Details
Accession A0A0C9XL88    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-44KGGPKTSKVCKEKWKRLRKTFEVIEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 12.5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences MNFKATFWNAASDALSNPSKGGPKTSKVCKEKWKRLRKTFEVIECIKNTSGLTYLRELGANVGLESEAVWNDFIKIHKDANSFRNRGWPHYDKMKQLMPSKGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.15
4 0.15
5 0.16
6 0.2
7 0.19
8 0.26
9 0.26
10 0.32
11 0.4
12 0.49
13 0.56
14 0.57
15 0.63
16 0.66
17 0.72
18 0.76
19 0.79
20 0.81
21 0.81
22 0.86
23 0.89
24 0.84
25 0.82
26 0.77
27 0.71
28 0.67
29 0.59
30 0.53
31 0.43
32 0.39
33 0.31
34 0.25
35 0.2
36 0.14
37 0.13
38 0.1
39 0.11
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.09
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.08
60 0.09
61 0.12
62 0.14
63 0.16
64 0.2
65 0.25
66 0.29
67 0.36
68 0.44
69 0.43
70 0.42
71 0.49
72 0.46
73 0.47
74 0.51
75 0.48
76 0.45
77 0.54
78 0.58
79 0.54
80 0.58
81 0.59
82 0.58
83 0.59
84 0.63