Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0AFB4

Protein Details
Accession A0A0D0AFB4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPETTHRKPRPKLAPYVRKPRQKPSQDHydrophilic
NLS Segment(s)
PositionSequence
7-21RKPRPKLAPYVRKPR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MPETTHRKPRPKLAPYVRKPRQKPSQDMPTTSAKDEQTTSRENLTLYDWMTVFTYIDEHPGASQEDIVQHFATKKTGALLFTQSTLSRKLKARLDLEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.87
4 0.86
5 0.85
6 0.83
7 0.82
8 0.82
9 0.79
10 0.78
11 0.75
12 0.78
13 0.72
14 0.7
15 0.63
16 0.6
17 0.54
18 0.47
19 0.42
20 0.31
21 0.28
22 0.27
23 0.26
24 0.22
25 0.23
26 0.23
27 0.2
28 0.2
29 0.19
30 0.18
31 0.17
32 0.15
33 0.12
34 0.12
35 0.1
36 0.1
37 0.1
38 0.09
39 0.08
40 0.06
41 0.07
42 0.06
43 0.08
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.08
50 0.08
51 0.07
52 0.09
53 0.11
54 0.12
55 0.11
56 0.11
57 0.13
58 0.14
59 0.15
60 0.13
61 0.12
62 0.14
63 0.16
64 0.16
65 0.16
66 0.2
67 0.19
68 0.2
69 0.21
70 0.2
71 0.2
72 0.25
73 0.26
74 0.28
75 0.32
76 0.39
77 0.44
78 0.51