Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A1X4

Protein Details
Accession A0A0D0A1X4   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-44LDTYDNPRKPHKRRYRCKTCGVCAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011057  Mss4-like_sf  
Amino Acid Sequences MHFVDTDFRWTTTGDPLETALDTYDNPRKPHKRRYRCKTCGVCAVSYNKITKRFSVYAGAVKRDADGKILNWEIIKPTAHQFYGTRVMDIEDGLDKWEGYEGNSTRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.2
5 0.2
6 0.18
7 0.11
8 0.09
9 0.09
10 0.14
11 0.2
12 0.23
13 0.25
14 0.35
15 0.45
16 0.52
17 0.63
18 0.69
19 0.73
20 0.8
21 0.89
22 0.9
23 0.87
24 0.9
25 0.86
26 0.8
27 0.77
28 0.69
29 0.59
30 0.51
31 0.48
32 0.4
33 0.35
34 0.34
35 0.28
36 0.31
37 0.3
38 0.29
39 0.31
40 0.29
41 0.28
42 0.28
43 0.26
44 0.27
45 0.28
46 0.28
47 0.22
48 0.21
49 0.2
50 0.18
51 0.17
52 0.12
53 0.12
54 0.11
55 0.15
56 0.15
57 0.16
58 0.14
59 0.14
60 0.14
61 0.15
62 0.15
63 0.12
64 0.16
65 0.19
66 0.19
67 0.2
68 0.19
69 0.22
70 0.31
71 0.29
72 0.26
73 0.23
74 0.24
75 0.22
76 0.21
77 0.17
78 0.1
79 0.1
80 0.11
81 0.11
82 0.1
83 0.1
84 0.12
85 0.1
86 0.1
87 0.19
88 0.18