Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9YCS2

Protein Details
Accession A0A0C9YCS2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-81VYNLLFKPRKCKRRRQETYRSGNTSIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MFEYQSAFVPTGVLERLLPRRFSTSPCNRWRWRGAVLVFPVRSLATVKSRREMPCVYNLLFKPRKCKRRRQETYRSGNTSINSYFAEIVQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.22
4 0.25
5 0.26
6 0.26
7 0.32
8 0.33
9 0.36
10 0.42
11 0.44
12 0.51
13 0.57
14 0.64
15 0.62
16 0.66
17 0.67
18 0.61
19 0.54
20 0.51
21 0.44
22 0.41
23 0.41
24 0.4
25 0.34
26 0.3
27 0.27
28 0.2
29 0.19
30 0.14
31 0.13
32 0.16
33 0.22
34 0.23
35 0.26
36 0.32
37 0.32
38 0.36
39 0.37
40 0.31
41 0.32
42 0.35
43 0.33
44 0.33
45 0.33
46 0.38
47 0.41
48 0.4
49 0.43
50 0.49
51 0.59
52 0.6
53 0.71
54 0.72
55 0.78
56 0.87
57 0.87
58 0.89
59 0.89
60 0.92
61 0.9
62 0.85
63 0.76
64 0.69
65 0.6
66 0.54
67 0.44
68 0.36
69 0.27
70 0.23
71 0.2