Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DIC9

Protein Details
Accession E9DIC9   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-33LNSGAAHPQKPKRKSKSKVADSWEDEHydrophilic
124-146MLENERRKRERERELARQRREDEBasic
NLS Segment(s)
PositionSequence
17-23KPKRKSK
129-142RRKRERERELARQR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAPEGSTLNSGAAHPQKPKRKSKSKVADSWEDESVSSEPSEDEKDEKATNATSSPQGQAYHSDVPSFAASSTPQWSSPDPRNPDSDSPRRRPEKQTAVASRIISSALGVRAKRTEEQKAYDRAMLENERRKRERERELARQRREDEEKAKQAVWES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.41
3 0.5
4 0.59
5 0.69
6 0.73
7 0.78
8 0.81
9 0.85
10 0.87
11 0.86
12 0.86
13 0.82
14 0.81
15 0.74
16 0.7
17 0.61
18 0.5
19 0.4
20 0.34
21 0.28
22 0.19
23 0.14
24 0.11
25 0.1
26 0.11
27 0.13
28 0.11
29 0.13
30 0.13
31 0.16
32 0.16
33 0.17
34 0.16
35 0.15
36 0.15
37 0.14
38 0.14
39 0.14
40 0.15
41 0.15
42 0.16
43 0.16
44 0.15
45 0.17
46 0.2
47 0.22
48 0.2
49 0.19
50 0.17
51 0.18
52 0.17
53 0.14
54 0.1
55 0.07
56 0.07
57 0.08
58 0.11
59 0.1
60 0.1
61 0.12
62 0.13
63 0.17
64 0.23
65 0.29
66 0.32
67 0.33
68 0.35
69 0.37
70 0.41
71 0.44
72 0.48
73 0.48
74 0.5
75 0.57
76 0.59
77 0.61
78 0.62
79 0.64
80 0.64
81 0.64
82 0.66
83 0.62
84 0.6
85 0.58
86 0.52
87 0.43
88 0.34
89 0.26
90 0.17
91 0.13
92 0.11
93 0.1
94 0.13
95 0.13
96 0.14
97 0.16
98 0.19
99 0.23
100 0.26
101 0.32
102 0.33
103 0.38
104 0.43
105 0.47
106 0.47
107 0.45
108 0.41
109 0.33
110 0.34
111 0.35
112 0.36
113 0.4
114 0.45
115 0.52
116 0.54
117 0.57
118 0.62
119 0.66
120 0.68
121 0.7
122 0.71
123 0.74
124 0.82
125 0.88
126 0.86
127 0.84
128 0.77
129 0.75
130 0.74
131 0.71
132 0.68
133 0.68
134 0.68
135 0.63
136 0.61