Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9Z0C1

Protein Details
Accession A0A0C9Z0C1   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-51RASSRYMKHSKNKKAPKQVAKEVSKHydrophilic
NLS Segment(s)
PositionSequence
33-54MKHSKNKKAPKQVAKEVSKKAQ
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029188  Rrp14_N  
Pfam View protein in Pfam  
PF15459  RRP14  
Amino Acid Sequences MTRSRRCSVPSLLKRYRVEDDDAGGPRASSRYMKHSKNKKAPKQVAKEVSKKAQREKLDLAIHKSIVDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.63
4 0.55
5 0.5
6 0.41
7 0.38
8 0.35
9 0.33
10 0.3
11 0.24
12 0.21
13 0.17
14 0.16
15 0.15
16 0.12
17 0.12
18 0.2
19 0.27
20 0.34
21 0.43
22 0.52
23 0.61
24 0.69
25 0.77
26 0.77
27 0.81
28 0.84
29 0.85
30 0.83
31 0.82
32 0.82
33 0.79
34 0.77
35 0.72
36 0.71
37 0.68
38 0.65
39 0.65
40 0.63
41 0.6
42 0.59
43 0.58
44 0.58
45 0.59
46 0.59
47 0.57
48 0.52
49 0.49