Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A133

Protein Details
Accession A0A0D0A133    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
63-82PSSFHPYKLKRRLSRSCTLNHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, E.R. 3, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MARCGKRRTPRVGGVFGTKLVVLALPLVHPAILRWRRGLPYHINPSTSAVRNAGNVSLRLSFPSSFHPYKLKRRLSRSCTLNIHCTIRSFSYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.54
3 0.45
4 0.37
5 0.28
6 0.21
7 0.15
8 0.12
9 0.07
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.15
19 0.19
20 0.2
21 0.22
22 0.24
23 0.27
24 0.29
25 0.34
26 0.31
27 0.36
28 0.43
29 0.42
30 0.4
31 0.38
32 0.4
33 0.39
34 0.32
35 0.25
36 0.17
37 0.16
38 0.16
39 0.17
40 0.15
41 0.12
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.14
48 0.12
49 0.12
50 0.18
51 0.24
52 0.24
53 0.26
54 0.34
55 0.38
56 0.49
57 0.58
58 0.61
59 0.63
60 0.71
61 0.8
62 0.79
63 0.81
64 0.76
65 0.74
66 0.73
67 0.69
68 0.66
69 0.61
70 0.58
71 0.5
72 0.47
73 0.42