Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9Z950

Protein Details
Accession A0A0C9Z950    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-35LAYWWNRLTKRQKRIVSSRAFVHydrophilic
256-276LDEMSTKRRRDKERMKQAGLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 11, cyto 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR006955  Uso1_p115_C  
IPR006953  Vesicle_Uso1_P115_head  
Gene Ontology GO:0000139  C:Golgi membrane  
GO:0006886  P:intracellular protein transport  
GO:0048280  P:vesicle fusion with Golgi apparatus  
Pfam View protein in Pfam  
PF04871  Uso1_p115_C  
PF04869  Uso1_p115_head  
Amino Acid Sequences MQNPLESFWMLAGLAYWWNRLTKRQKRIVSSRAFVHSFWVCAMSLTASQVRLRGESCFLCLSPPFCSLMNVINACSLVTVYLAPSRSTIHAIISRLTVDALVGHITRVREDDCFKSVGPECMVLLWPTSSSSGALASNQRAQEQEGEIWFDWAFVDFWKSNQYAVQRALGSDPNSLTTSSGPSAESMMLIGSLRDVIRAQAEEIDVLKSKLKDLSAGVTEVNELKSRVGELESVIQAAEEKRKSVEKEQDDLLVLLDEMSTKRRRDKERMKQAGLEVSEDEEEGEEADDEEDGDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.14
5 0.18
6 0.2
7 0.3
8 0.4
9 0.46
10 0.55
11 0.64
12 0.7
13 0.75
14 0.83
15 0.83
16 0.81
17 0.76
18 0.71
19 0.68
20 0.62
21 0.52
22 0.48
23 0.4
24 0.32
25 0.28
26 0.23
27 0.17
28 0.15
29 0.16
30 0.12
31 0.11
32 0.13
33 0.14
34 0.14
35 0.15
36 0.17
37 0.18
38 0.18
39 0.18
40 0.17
41 0.2
42 0.19
43 0.21
44 0.2
45 0.19
46 0.19
47 0.2
48 0.2
49 0.18
50 0.19
51 0.18
52 0.16
53 0.18
54 0.17
55 0.19
56 0.23
57 0.2
58 0.19
59 0.18
60 0.18
61 0.16
62 0.15
63 0.11
64 0.06
65 0.05
66 0.05
67 0.05
68 0.08
69 0.09
70 0.1
71 0.11
72 0.12
73 0.13
74 0.16
75 0.15
76 0.16
77 0.18
78 0.19
79 0.19
80 0.18
81 0.17
82 0.14
83 0.14
84 0.1
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.08
92 0.08
93 0.09
94 0.1
95 0.1
96 0.11
97 0.14
98 0.17
99 0.17
100 0.18
101 0.18
102 0.21
103 0.21
104 0.21
105 0.19
106 0.17
107 0.15
108 0.14
109 0.14
110 0.1
111 0.09
112 0.07
113 0.06
114 0.06
115 0.07
116 0.07
117 0.06
118 0.06
119 0.07
120 0.07
121 0.08
122 0.09
123 0.1
124 0.13
125 0.14
126 0.14
127 0.13
128 0.14
129 0.14
130 0.14
131 0.13
132 0.1
133 0.12
134 0.11
135 0.12
136 0.11
137 0.09
138 0.08
139 0.07
140 0.07
141 0.05
142 0.08
143 0.07
144 0.08
145 0.11
146 0.12
147 0.11
148 0.14
149 0.16
150 0.16
151 0.17
152 0.2
153 0.17
154 0.17
155 0.18
156 0.19
157 0.18
158 0.16
159 0.15
160 0.14
161 0.14
162 0.14
163 0.13
164 0.11
165 0.11
166 0.11
167 0.11
168 0.09
169 0.09
170 0.1
171 0.09
172 0.08
173 0.06
174 0.06
175 0.05
176 0.05
177 0.04
178 0.03
179 0.05
180 0.05
181 0.05
182 0.06
183 0.06
184 0.08
185 0.08
186 0.09
187 0.09
188 0.09
189 0.09
190 0.1
191 0.11
192 0.1
193 0.1
194 0.13
195 0.12
196 0.13
197 0.15
198 0.14
199 0.15
200 0.15
201 0.19
202 0.17
203 0.18
204 0.16
205 0.14
206 0.15
207 0.14
208 0.14
209 0.11
210 0.1
211 0.1
212 0.1
213 0.11
214 0.11
215 0.11
216 0.1
217 0.1
218 0.14
219 0.14
220 0.13
221 0.12
222 0.11
223 0.12
224 0.13
225 0.19
226 0.15
227 0.16
228 0.19
229 0.24
230 0.29
231 0.36
232 0.44
233 0.43
234 0.46
235 0.47
236 0.46
237 0.42
238 0.38
239 0.3
240 0.2
241 0.15
242 0.11
243 0.09
244 0.07
245 0.07
246 0.13
247 0.18
248 0.21
249 0.3
250 0.39
251 0.48
252 0.58
253 0.68
254 0.74
255 0.8
256 0.87
257 0.83
258 0.79
259 0.74
260 0.7
261 0.6
262 0.51
263 0.4
264 0.32
265 0.28
266 0.23
267 0.19
268 0.12
269 0.11
270 0.09
271 0.09
272 0.07
273 0.07
274 0.07
275 0.07
276 0.07