Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZQT8

Protein Details
Accession A0A0C9ZQT8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPAEKRKPCNNPPPYNRKPKVAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MPAEKRKPCNNPPPYNRKPKVAKVKDAPATSARPTIHASRKNLTLNDWLTVFAYIDSHPTLPQANVVDHFKTLPSGALIFTQSTLSRKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.83
4 0.81
5 0.78
6 0.78
7 0.79
8 0.76
9 0.76
10 0.72
11 0.76
12 0.74
13 0.67
14 0.6
15 0.52
16 0.47
17 0.4
18 0.38
19 0.29
20 0.24
21 0.26
22 0.3
23 0.34
24 0.37
25 0.39
26 0.37
27 0.41
28 0.42
29 0.4
30 0.35
31 0.33
32 0.28
33 0.25
34 0.22
35 0.17
36 0.15
37 0.14
38 0.12
39 0.07
40 0.07
41 0.06
42 0.07
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.09
49 0.12
50 0.12
51 0.12
52 0.15
53 0.18
54 0.18
55 0.17
56 0.17
57 0.15
58 0.14
59 0.13
60 0.11
61 0.1
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.12
68 0.13
69 0.14
70 0.16