Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9ZRZ4

Protein Details
Accession A0A0C9ZRZ4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-76ILRDWYPHRQPDRKGRWRRSIVPCDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 3.5, mito 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MYIYPKVGDLTCNDTITSISCKRYVMNKNVRPLPTTVPSPAYSPKNRDFPILRDWYPHRQPDRKGRWRRSIVPCDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.24
5 0.21
6 0.2
7 0.2
8 0.21
9 0.23
10 0.31
11 0.36
12 0.4
13 0.48
14 0.51
15 0.57
16 0.63
17 0.62
18 0.54
19 0.49
20 0.43
21 0.36
22 0.32
23 0.26
24 0.23
25 0.23
26 0.23
27 0.25
28 0.27
29 0.27
30 0.31
31 0.34
32 0.39
33 0.39
34 0.43
35 0.4
36 0.38
37 0.43
38 0.44
39 0.39
40 0.37
41 0.42
42 0.46
43 0.5
44 0.55
45 0.55
46 0.56
47 0.63
48 0.69
49 0.75
50 0.77
51 0.81
52 0.83
53 0.85
54 0.86
55 0.88
56 0.88