Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DA28

Protein Details
Accession E9DA28   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
137-162NLHATCCRARSRPRKARNGIVGIKRTHydrophilic
NLS Segment(s)
PositionSequence
148-152RPRKA
Subcellular Location(s) nucl 10, mito 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MRKKEGKEKCETSGNLGERAIPRSRALPADTANRTRLWNHYCICGLTQGTGAGMDNYGGIRRRIAGAPTIIRCGLQCVDMDPRRFPACPRGLFFSSKTAVRGARFTPLAKHIQARRTRAFQKPPPRLPSLEASQPLNLHATCCRARSRPRKARNGIVGIKRTGTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.46
3 0.41
4 0.4
5 0.34
6 0.37
7 0.33
8 0.27
9 0.26
10 0.26
11 0.29
12 0.27
13 0.27
14 0.27
15 0.27
16 0.33
17 0.37
18 0.38
19 0.37
20 0.36
21 0.35
22 0.33
23 0.37
24 0.33
25 0.35
26 0.32
27 0.34
28 0.34
29 0.33
30 0.32
31 0.27
32 0.23
33 0.17
34 0.16
35 0.12
36 0.11
37 0.1
38 0.09
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.07
45 0.08
46 0.08
47 0.08
48 0.09
49 0.11
50 0.12
51 0.13
52 0.14
53 0.15
54 0.19
55 0.19
56 0.2
57 0.18
58 0.17
59 0.16
60 0.16
61 0.13
62 0.1
63 0.09
64 0.09
65 0.17
66 0.2
67 0.22
68 0.2
69 0.22
70 0.23
71 0.23
72 0.22
73 0.24
74 0.27
75 0.28
76 0.29
77 0.32
78 0.33
79 0.35
80 0.35
81 0.3
82 0.26
83 0.24
84 0.23
85 0.2
86 0.2
87 0.19
88 0.2
89 0.17
90 0.19
91 0.2
92 0.2
93 0.2
94 0.22
95 0.25
96 0.24
97 0.29
98 0.3
99 0.37
100 0.42
101 0.47
102 0.47
103 0.51
104 0.56
105 0.58
106 0.63
107 0.64
108 0.68
109 0.72
110 0.75
111 0.74
112 0.72
113 0.65
114 0.59
115 0.56
116 0.5
117 0.46
118 0.4
119 0.36
120 0.34
121 0.32
122 0.3
123 0.27
124 0.22
125 0.17
126 0.17
127 0.21
128 0.21
129 0.24
130 0.28
131 0.33
132 0.43
133 0.53
134 0.62
135 0.67
136 0.75
137 0.83
138 0.85
139 0.88
140 0.86
141 0.85
142 0.82
143 0.8
144 0.75
145 0.67
146 0.6